TIMM8B Antibody (2G7) - Azide and BSA Free

Sandwich ELISA: TIMM8B Antibody (2G7) [H00026521-M01] - Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM8B Antibody (2G7) - Azide and BSA Free Summary

• Immunogen: TIMM8B (NP_036591, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
• Specificity: TIMM8B - translocase of inner mitochondrial membrane 8 homolog B (yeast) (2G7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TIMM8B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8B Antibody (2G7) - Azide and BSA Free

• DDP2DDP-like protein
• DDPL
• Deafness dystonia protein 2
• FLJ21744
• MGC102866
• MGC117373
• mitochondrial import inner membrane translocase subunit Tim8 B
• TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B
• translocase of inner mitochondrial membrane 8 homolog B (yeast)

Background

TIMM8B belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM8B
• Entrez:
  • 26521(Human)
• Uniprot:
  • NP_036591(Human)