TIMM8A Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

TIMM8A Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human TIMM8A (NP_004076.1).
  
  Sequence:
  MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMM8A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for TIMM8A Antibody [DyLight 650]

• DDP1deafness/dystonia peptide
• DDPMGC12262
• Deafness dystonia protein 1
• DFN1
• mitochondrial import inner membrane translocase subunit Tim8 A
• MTSTIM8
• TIM8A
• translocase of inner mitochondrial membrane 8 (yeast) homolog A
• translocase of inner mitochondrial membrane 8 homolog A (yeast)
• X-linked deafness dystonia protein

Background

This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM8A