TIMM8A Antibody (1A12)


Sandwich ELISA: TIMM8A Antibody (1A12) [H00001678-M04] - Detection limit for recombinant GST tagged TIMM8A is 1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

TIMM8A Antibody (1A12) Summary

TIMM8A (AAH05236, 1 a.a. - 72 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN
TIMM8A - translocase of inner mitochondrial membrane 8 homolog A (yeast) (1A12)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8A Antibody (1A12)

  • DDP1deafness/dystonia peptide
  • DDPMGC12262
  • Deafness dystonia protein 1
  • DFN1
  • mitochondrial import inner membrane translocase subunit Tim8 A
  • TIM8A
  • translocase of inner mitochondrial membrane 8 (yeast) homolog A
  • translocase of inner mitochondrial membrane 8 homolog A (yeast)
  • X-linked deafness dystonia protein


This translocase has similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Deafness Dystonia Syndrome (MTS/DFN-1) and it is postulated that MTS/DFN-1 is a mitochondrial disease caused by a defective mitochondrial protein import system. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for TIMM8A Antibody (H00001678-M04) (0)

There are no publications for TIMM8A Antibody (H00001678-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM8A Antibody (H00001678-M04) (0)

There are no reviews for TIMM8A Antibody (H00001678-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM8A Antibody (H00001678-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TIMM8A Products

Bioinformatics Tool for TIMM8A Antibody (H00001678-M04)

Discover related pathways, diseases and genes to TIMM8A Antibody (H00001678-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM8A Antibody (H00001678-M04)

Discover more about diseases related to TIMM8A Antibody (H00001678-M04).

Pathways for TIMM8A Antibody (H00001678-M04)

View related products by pathway.

PTMs for TIMM8A Antibody (H00001678-M04)

Learn more about PTMs related to TIMM8A Antibody (H00001678-M04).

Research Areas for TIMM8A Antibody (H00001678-M04)

Find related products by research area.

Blogs on TIMM8A

There are no specific blogs for TIMM8A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIMM8A Antibody (1A12) and receive a gift card or discount.


Gene Symbol TIMM8A