TIMM17B Antibody


Western Blot: TIMM17B Antibody [NBP1-84036] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TIMM17B Antibody [NBP1-84036] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TIMM17B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Specificity of human TIMM17B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Positive Control
TIMM17B Lysate (NBP2-66345)
Control Peptide
TIMM17B Protein (NBP1-84036PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TIMM17B Antibody

  • inner mitochondrial membrane preprotein translocase
  • JM3
  • mitochondrial import inner membrane translocase subunit Tim17-B
  • TIM17BDXS9822
  • translocase of inner mitochondrial membrane 17 homolog B (yeast)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Fe, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TIMM17B Antibody (NBP1-84036) (0)

There are no publications for TIMM17B Antibody (NBP1-84036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM17B Antibody (NBP1-84036) (0)

There are no reviews for TIMM17B Antibody (NBP1-84036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM17B Antibody (NBP1-84036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TIMM17B Products

Bioinformatics Tool for TIMM17B Antibody (NBP1-84036)

Discover related pathways, diseases and genes to TIMM17B Antibody (NBP1-84036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TIMM17B

There are no specific blogs for TIMM17B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIMM17B Antibody and receive a gift card or discount.


Gene Symbol TIMM17B