TIMM17B Antibody

Western Blot: TIMM17B Antibody [NBP1-84036] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: TIMM17B Antibody [NBP1-84036] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TIMM17B Antibody [NBP1-84036] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TIMM17B Antibody [NBP1-84036] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TIMM17B Antibody [NBP1-84036] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TIMM17B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMM17B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TIMM17B Protein (NBP1-84036PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TIMM17B Antibody

• inner mitochondrial membrane preprotein translocase
• JM3
• mitochondrial import inner membrane translocase subunit Tim17-B
• TIM17BDXS9822
• translocase of inner mitochondrial membrane 17 homolog B (yeast)

Background

The TIMM17B gene encodes a protein that is part of the mitochondrial transport TIMM23 complex. TIM translocase complexes facilitate the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. Two a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM17B