CCDC22 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CCDC22 Antibody [NBP1-84331] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CCDC22 Antibody [NBP1-84331] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCDC22 Antibody - BSA Free (NBP1-84331) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CCDC22 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25880334). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCDC22 Protein (NBP1-84331PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25880334).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC22 Antibody - BSA Free

• chromosome X open reading frame 37
• coiled-coil domain containing 22
• coiled-coil domain-containing protein 22
• CXorf37
• JM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCDC22 Antibody (NBP1-84331)(1)

Publication using NBP1-84331

• Mateusz Kolanczyk, Peter Krawitz, Jochen Hecht et al. Missense variant in CCDC22 causes X-linked recessive intellectual disability with features of Ritscher-Schinzel/3C syndrome. European Journal of Human Genetics 2014-06-11 [PMID: 25880334] (WB, Human)

Bioinformatics

• Gene Symbol: CCDC22