CCDC22 Antibody

Images

 
Western Blot: CCDC22 Antibody [NBP1-84331] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CCDC22 Antibody [NBP1-84331] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CCDC22 Antibody [NBP1-84331] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: CCDC22 Antibody [NBP1-84331] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC22 Protein (NBP1-84331PEP)
Publications
Read Publication using
NBP1-84331 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25880334).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC22 Antibody

  • chromosome X open reading frame 37
  • coiled-coil domain containing 22
  • coiled-coil domain-containing protein 22
  • CXorf37
  • JM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81628
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF6486
Species: Hu
Applications: WB, Simple Western
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC

Publications for CCDC22 Antibody (NBP1-84331)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CCDC22 Antibody (NBP1-84331) (0)

There are no reviews for CCDC22 Antibody (NBP1-84331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC22 Antibody (NBP1-84331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC22 Products

Bioinformatics Tool for CCDC22 Antibody (NBP1-84331)

Discover related pathways, diseases and genes to CCDC22 Antibody (NBP1-84331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC22 Antibody (NBP1-84331)

Discover more about diseases related to CCDC22 Antibody (NBP1-84331).

Blogs on CCDC22

There are no specific blogs for CCDC22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC22