TIGD7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TIGD7 Antibody [NBP1-80790] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Immunohistochemistry: TIGD7 Antibody [NBP1-80790] - Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIGD7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TIGD7 Antibody - BSA Free (NBP1-80790) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TIGD7 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGDYREILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDFVDATPEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIGD7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation
• Control Peptide:

  TIGD7 Protein (NBP1-80790PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TIGD7 Antibody - BSA Free

• tigger transposable element derived 7

Background

The protein encoded by the TIGD7 gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons inhumans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 andmariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function ofthis gene is not known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIGD7 Antibody (NBP1-80790)(2)

Publications using NBP1-80790

• Todorova V, Merolla L, Karademir D et al. Retinal Layer Separation (ReLayS) method enables the molecular analysis of photoreceptor segments and cell bodies, as well as the inner retina Scientific reports 2022-11-23 [PMID: 36424523] (WB, Mouse)
  
  Details:
  Dilutions: 1:5000
• Pakalniskyte D, SchOnberger T, Strobel B et al. Rosa26-LSL-dCas9-VPR: a versatile mouse model for tissue specific and simultaneous activation of multiple genes for drug discovery Scientific reports 2022-11-10 [PMID: 36357523] (Simple Western, Mouse)
  
  Details:
  Dilution used in Simple Western 1:20

Bioinformatics

• Gene Symbol: TIGD7
• Entrez:
  • 91151(Human)