JRK Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LELVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQAAVAFDAVLRFAERQPCFSA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
JRK |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for JRK Antibody - BSA Free
Background
JRK is the human homolog of the mouse jerky gene. The encoded protein has similarity to several nuclear regulatory proteins, including centromere protein B, suggesting that it might function as a DNA-binding protein. Insertional inactivation of this gene in transgenic mice resulted in epileptic seizures. Childhood Absence Epilepsy (CAE) has been mapped to the same chromosomal location (8q24.3) as this gene, making this gene a strong candidate for CAE. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Publications for JRK Antibody (NBP2-55780) (0)
There are no publications for JRK Antibody (NBP2-55780).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JRK Antibody (NBP2-55780) (0)
There are no reviews for JRK Antibody (NBP2-55780).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JRK Antibody (NBP2-55780) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JRK Products
Blogs on JRK