JRK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: JRK Antibody [NBP2-55780] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JRK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LELVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQAAVAFDAVLRFAERQPCFSA
Specificity
Specificity of human JRK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JRK
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JRK Recombinant Protein Antigen (NBP2-55780PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for JRK Antibody

  • DKFZp686C24207
  • FLJ45729
  • jerky homolog (mouse)
  • jerky protein homolog
  • JH8jerky (mouse) homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40853
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-24589
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IB, IHC, IHC-P, KO
NBP1-76701
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-31470
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001059-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-80790
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-68799
Species: Hu
Applications: IHC, IHC-P

Publications for JRK Antibody (NBP2-55780) (0)

There are no publications for JRK Antibody (NBP2-55780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JRK Antibody (NBP2-55780) (0)

There are no reviews for JRK Antibody (NBP2-55780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for JRK Antibody (NBP2-55780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional JRK Products

Bioinformatics Tool for JRK Antibody (NBP2-55780)

Discover related pathways, diseases and genes to JRK Antibody (NBP2-55780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JRK Antibody (NBP2-55780)

Discover more about diseases related to JRK Antibody (NBP2-55780).
 

Pathways for JRK Antibody (NBP2-55780)

View related products by pathway.

Blogs on JRK

There are no specific blogs for JRK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JRK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JRK