ZNF828 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF828 Antibody [NBP1-88402] - Staining of human cell line U-2 OS shows localization to nucleoplasm & midbody ring.

Staining of human endometrium, lymph node, pancreas and small intestine using Anti-CHAMP1 antibody NBP1-88402 (A) shows similar protein distribution across tissues to independent antibody NBP1-88403 (B).

Immunohistochemistry-Paraffin: ZNF828 Antibody [NBP1-88402] - Staining of human lymph node.

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells and germinal center cells.

Staining of human endometrium shows strong nuclear positivity in glandular cells and endometrial stromal cells.

Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Staining of human small intestine shows strong nuclear positivity in glandular cells with additional moderate cytoplasmic positivity.

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CHAMP1 antibody. Remaining relative intensity is presented.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF828 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF828 Antibody - BSA Free (NBP1-88402) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHAMP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF828 Protein (NBP1-88402PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF828 Antibody - BSA Free

• C13orf8
• CAMPchromosome 13 open reading frame 8
• Chromosome alignment-maintaining phosphoprotein
• FLJ90413
• KIAA1802
• zinc finger protein 828

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHAMP1