Home » TIF1 gamma » TIF1 gamma Antibodies » TIF1 gamma Antibody (6D1)

TIF1 gamma Antibody (6D1)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Immunocytochemistry/ Immunofluorescence: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in PC-12.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in NIH/3T3.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in HeLa.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in Raw 264.7.
ELISA: TIF1 gamma Antibody (6D1) [H00051592-M01] - Detection limit for recombinant GST tagged TRIM33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIF1 gamma Antibody (6D1) Summary

Immunogen
TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS
Localization
Nuclear
Specificity
TRIM33 - tripartite motif-containing 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00051592-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 gamma Antibody (6D1)

  • E3 ubiquitin-protein ligase TRIM33
  • EC 6.3.2
  • EC 6.3.2.-
  • Ectodermin homolog
  • KIAA1113
  • Protein Rfg7
  • PTC7FLJ32925
  • RET-fused gene 7 protein
  • RFG7FLJ11429
  • TF1G
  • TIF1GAMMA
  • TIF1-gamma
  • TIF1GECTO
  • TIFGAMMA
  • Transcription intermediary factor 1-gamma
  • transcriptional intermediary factor 1 gamma
  • tripartite motif containing 33
  • tripartite motif-containing 33
  • Tripartite motif-containing protein 33

Background

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
Smad4 Antibody
NBP2-24951
Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.
Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: Smad4 Antibody [NBP2-24951] - SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/mL.
(3 Reviews)
(2 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TIF1 alpha
Antibody (2F2)
H00008805-M01
Immunocytochemistry/Immunofluorescence: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. Antibody concentration 6 ug/ml.
Immunoprecipitation: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM24 MaxPab rabbit polyclonal antibody.
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
NCOA4 Antibody -
BSA Free
NBP3-18136
Western Blot: NCOA4 Antibody - BSA Free [NBP3-18136] - Western Blot Validation in Human Cell Lines. Loading: 15 ug of lysates per lane. Antibodies: NCOA4 NBP3-18136, 0.5 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: NCOA4 Antibody - BSA Free [NBP3-18136] - Western Blot Validation in Mouse Tissues. Loading: 15 ug of lysates per lane. Antibodies: NCOA4 NBP3-18136, 1 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: NCOA4 Antibody - BSA Free [NBP3-18136] - Western Blot Validation in Rat Tissues. Loading: 15 ug of lysates per lane. Antibodies: NCOA4 NBP3-18136, 1 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Recombinant human TGF-beta 1 (7754-BH/CF) inhibits recombinant mouse IL-4 induced proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.04-0.2 ng/mL.
(42 Publications)
Species: Hu
Applications: BA
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Patched 1/PTCH
Antibody (OTI5C7)
NBP1-47945
Immunocytochemistry/Immunofluorescence: Patched 1/PTCH Antibody (OTI5C7) [NBP1-47945] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Patched 1.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody (5c7) [NBP1-47945] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-Patched 1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody (5c7) [NBP1-47945] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Patched 1 mouse monoclonal antibody.
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
ENPP-2/Autotaxin
[Unconjugated]
5255-EN
ENPP-2/Autotaxin [Unconjugated]
(5 Publications)
Species: Hu
Applications: EnzAct
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(29 Publications)
Species: Mu
Applications: IHC, WB
USP9x Antibody
NBP1-48321
Immunocytochemistry/Immunofluorescence: USP9x Antibody [NBP1-48321] - ICC/IC analysis of USP9x in mouse ES cell line 129. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: USP9x Antibody [NBP1-48321] - Immunocytochemical analysis of USP9X in NTERA-2 cells
Western Blot: USP9x Antibody [NBP1-48321] - Analysis of USP9X in Caco-2 whole cell lysates.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Nogo Receptor/NgR
Antibody
AF1440
Nogo Receptor/NgR Antibody
(1 Review)
(12 Publications)
Species: Mu
Applications: WB
KAP1 [p Ser824]
Antibody
NB100-2350
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - FFPE serial sections of asynchronous HeLa cells treated with EPE (left) anduntreated HeLa cells (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB
Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LOX Antibody
NB100-2527
Immunocytochemistry/Immunofluorescence: LOX Antibody [NB100-2527] - Staining in human fibroblasts. Image from verified customer review.
Immunohistochemistry: LOX Antibody [NB100-2527] - IR-enhanced LOX in tumor xenografts. Tumor tissue from A549-derived tumor xenografts treated with 1 x 10 Gy and 2 x 10 Gy (with 12 h between fractions) and evaluated by immunohistochemistry for LOX at different time points after irradiation. Whole tumor sections were quantified for specific LOX-staining intensity. Each treatment group consists of 3 animals. At least 3 sections per tumor/animal were analyzed. Image collected and cropped by CiteAb from the following publication (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-532) licensed under a CC-BY licence.
Western Blot: LOX Antibody [NB100-2527] - LOX secretion and activity in response to tumor cell irradiation. Western blot of LOX zymogen (50 kDa) and active form (32 kDa) in conditioned media derived from irradiated A549 lung carcinoma cells 16-20 h after irradiation and quantification of band intensities from 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-532) licensed under a CC-BY licence.
(5 Reviews)
(29 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for TRIM at approximately 38 kDa (as indicated) using 20 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) . This experiment was conducted under reducing conditions and using the 12-230kDa separation system.
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
TIF1 gamma
Antibody (6D1)
H00051592-M01
TIF1 gamma Antibody (6D1)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TIF1 gamma Antibody (H00051592-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TIF1 gamma Antibody (H00051592-M01) (0)

There are no reviews for TIF1 gamma Antibody (H00051592-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 gamma Antibody (H00051592-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIF1 gamma Products

Bioinformatics Tool for TIF1 gamma Antibody (H00051592-M01)

Discover related pathways, diseases and genes to TIF1 gamma Antibody (H00051592-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 gamma Antibody (H00051592-M01)

Discover more about diseases related to TIF1 gamma Antibody (H00051592-M01).
 

Pathways for TIF1 gamma Antibody (H00051592-M01)

View related products by pathway.

PTMs for TIF1 gamma Antibody (H00051592-M01)

Learn more about PTMs related to TIF1 gamma Antibody (H00051592-M01).

Blogs on TIF1 gamma

There are no specific blogs for TIF1 gamma, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 gamma Antibody (6D1) and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM33
Entrez
OMIM
Uniprot