Home » TIF1 gamma » TIF1 gamma Antibodies » TIF1 gamma Antibody (6D1)

TIF1 gamma Antibody (6D1)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Immunocytochemistry/ Immunofluorescence: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in PC-12.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in NIH/3T3.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in HeLa.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in Raw 264.7.
ELISA: TIF1 gamma Antibody (6D1) [H00051592-M01] - Detection limit for recombinant GST tagged TRIM33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIF1 gamma Antibody (6D1) Summary

Immunogen
TRIM33 (NP_056990, 1006 a.a. ~ 1106 a.a) partial recombinant protein with GST tag.VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQV YADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPL PEFEQEEDDGEVTEDS
Localization
Nuclear
Specificity
TRIM33 - tripartite motif-containing 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00051592-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 gamma Antibody (6D1)

  • E3 ubiquitin-protein ligase TRIM33
  • EC 6.3.2
  • EC 6.3.2.-
  • Ectodermin homolog
  • KIAA1113
  • Protein Rfg7
  • PTC7FLJ32925
  • RET-fused gene 7 protein
  • RFG7FLJ11429
  • TF1G
  • TIF1GAMMA
  • TIF1-gamma
  • TIF1GECTO
  • TIFGAMMA
  • Transcription intermediary factor 1-gamma
  • transcriptional intermediary factor 1 gamma
  • tripartite motif containing 33
  • tripartite motif-containing 33
  • Tripartite motif-containing protein 33

Background

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


5'-Nucleotidase/CD73 A
NBP1-85740
Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.
Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong membranous positivity in glandular cells.
(4 Reviews)
(6 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC
Smad4 Antibody
[Unconjugated]
AF2097
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Smad4 at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Jurkat human acute T cell leukemia cell line treated with 10 ng/mL Recombinant Human IL‑12 (Catalog # 219-IL) overnight was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Smad4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) or control antibody (Catalog # AB‑108‑C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Smad4 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Goat Anti-Human Smad4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2097) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, ChIP, ICC
TIF1 alpha Antibody
NB100-2596
Western Blot: TIF1 alpha Antibody [NB100-2596] - Detection of Human and Mouse TIF1 Alpha/TRIM24 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-TIF1 Alpha/TRIM24 antibody NB100-2596 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry: TIF1 alpha Antibody [NB100-2596] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- TIF1 alpha/TRIM24 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: TIF1 alpha Antibody [NB100-2596] - Detection of Human and Mouse TIF1 alpha/TRIM24 on HeLa whole cell lysate using NB100-2596. TIF1 alpha/TRIM24 was also immunoprecipitated by rabbit anti-TIF1 alpha/TRIM24 antibody NB100-2597.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NCOA4 Antibody
(1B7)
H00008031-M04
Western Blot: NCOA4 Antibody (1B7) [H00008031-M04] - Analysis of NCOA4 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: NCOA4 Antibody (1B7) [H00008031-M04] - Analysis of monoclonal antibody to NCOA4 on NIH/3T3 cell. Antibody concentration 10 ug/ml
ELISA: NCOA4 Antibody (1B7) [H00008031-M04] - Detection limit for recombinant GST tagged NCOA4 is approximately 3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
TGF-beta 1
[Unconjugated]
7754-BH/CF
TGF-beta 1 [Unconjugated]
(3 Publications)
Species: Hu
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Patched 1/PTCH
Antibody
NBP1-71662
Western Blot: Patched 1/PTCH Antibody [NBP1-71662] - Analysis of Patched 1 in human skeletal muscle protein.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - KRAS monoclonal antibody (M01), clone 3B10-2F2 Analysis of KRAS expression in HeLa.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
ENPP-2/Autotaxin
5255-EN
ENPP-2/Autotaxin
(4 Publications)
Species: Hu
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(22 Publications)
Species: Mu
Applications: WB, IHC
USP9x Antibody
NBP1-48321
Western Blot: USP9x Antibody [NBP1-48321] - Analysis of USP9X in NIH/3T3 whole cell lysate.
Immunocytochemistry/Immunofluorescence: USP9x Antibody [NBP1-48321] - ICC/IC analysis of USP9x in mouse ES cell line 129. Image courtesy of anonymous customer product review.
Immunohistochemistry: USP9x Antibody [NBP1-48321] - IHC staining of Usp9x in brain tissue.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Nogo Receptor/NgR
Antibody
AF1440
Nogo Receptor/NgR Antibody
(2 Reviews)
(10 Publications)
Species: Mu
Applications: WB
KAP1 [p Ser824]
Antibody
NB100-2350
Western Blot: KAP1 [p Ser824] Antibody [NB100-2350] - Whole cell lysate (15 and 50 ug) from 293T cells treated with 100 uM etoposide (+) or mock treated (-). Antibodies: Affinity purified rabbit anti-Phospho KAP-1 (S824) antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower panel shows Western Blot for total KAP1-1 using affinity purified rabbit antiKAP-1 antibody at 0.1 ug/ml with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with etoposide (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB
(30 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LOX Antibody
NB100-2527
Western Blot: LOX Antibody [NB100-2527] - Analysis of LOX in human kidney using NB100-2527.
Immunocytochemistry/Immunofluorescence: LOX Antibody [NB100-2527] - Staining in human fibroblasts. Image from verified customer review.
Immunohistochemistry: LOX Antibody [NB100-2527] - Staining of LOX in mouse stomach.
(5 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
TIF1 gamma
Antibody (6D1)
H00051592-M01
TIF1 gamma Antibody (6D1)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TIF1 gamma Antibody (H00051592-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-Fr, WB.


Filter By Application
IHC-Fr
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for TIF1 gamma Antibody (H00051592-M01) (0)

There are no reviews for TIF1 gamma Antibody (H00051592-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 gamma Antibody (H00051592-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TIF1 gamma Antibody (H00051592-M01)

Discover related pathways, diseases and genes to TIF1 gamma Antibody (H00051592-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 gamma Antibody (H00051592-M01)

Discover more about diseases related to TIF1 gamma Antibody (H00051592-M01).
 

Pathways for TIF1 gamma Antibody (H00051592-M01)

View related products by pathway.

PTMs for TIF1 gamma Antibody (H00051592-M01)

Learn more about PTMs related to TIF1 gamma Antibody (H00051592-M01).

Blogs on TIF1 gamma

There are no specific blogs for TIF1 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 gamma Antibody (6D1) and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM33
Entrez
OMIM
Uniprot