Home » TIF1 gamma » TIF1 gamma Antibodies » TIF1 gamma Antibody (6D1)

TIF1 gamma Antibody (6D1)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in 293.
Immunocytochemistry/ Immunofluorescence: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: TIF1 gamma Antibody (6D1) [H00051592-M01] - Analysis of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in PC-12.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - Expression in NIH/3T3.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in HeLa.
Western Blot: TIF1 gamma Antibody (6D1) [H00051592-M01] - TRIM33 monoclonal antibody (M01), clone 6D1. Analysis of TRIM33 expression in Raw 264.7.
ELISA: TIF1 gamma Antibody (6D1) [H00051592-M01] - Detection limit for recombinant GST tagged TRIM33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TIF1 gamma Antibody (6D1) Summary

Immunogen
TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS
Localization
Nuclear
Specificity
TRIM33 - tripartite motif-containing 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00051592-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 gamma Antibody (6D1)

  • E3 ubiquitin-protein ligase TRIM33
  • EC 6.3.2
  • EC 6.3.2.-
  • Ectodermin homolog
  • KIAA1113
  • Protein Rfg7
  • PTC7FLJ32925
  • RET-fused gene 7 protein
  • RFG7FLJ11429
  • TF1G
  • TIF1GAMMA
  • TIF1-gamma
  • TIF1GECTO
  • TIFGAMMA
  • Transcription intermediary factor 1-gamma
  • transcriptional intermediary factor 1 gamma
  • tripartite motif containing 33
  • tripartite motif-containing 33
  • Tripartite motif-containing protein 33

Background

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


5'-Nucleotidase/CD73 A
NBP1-85740
Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.
Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for human aortic valve endothelial cells. Image from a verified customer review.
Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human liver shows strong membranous positivity in hepatocytes.
(4 Reviews)
(9 Publications)
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC
Smad4 Antibody
NBP2-24951
Western Blot: Smad4 Antibody [NBP2-24951] - SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.
(3 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P
TIF1 alpha Antibody
NB100-2596
Western Blot: TIF1 alpha Antibody [NB100-2596] - Detection of Human and Mouse TIF1 Alpha/TRIM24 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-TIF1 Alpha/TRIM24 antibody NB100-2596 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: TIF1 alpha Antibody [NB100-2596] - Section of mouse teratoma. Antibody: Affinity purified rabbit anti-TIF1alpha/TRIM24 used at a dilution of 1:200 (1ug/ml). Detection: DAB
Chromatin Immunoprecipitation Sequencing: TIF1 alpha Antibody [NB100-2596] - Localization of TIF1 Alpha/TRIM24 Binding Sites by ChIP-sequencing.Chromatin from Breast cancer cell line T47D was immunoprecipitated with anti-TIF1 Alpha/TRIM24 antibody NB100-2596 and analyzed by DNA sequencing. The figure illustrates the peak distribution of TIF1 Alpha/TRIM24 binding within a 250 Kb region of chromosome 19 as detected using anti-TIF1 Alpha/TRIM24 antibody NB100-2596. ChIP-seq validation performed by Active Motif, Carlsbad, CA.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, CHIP-SEQ
NCOA4 Antibody
(1F11)
H00008031-M05
Western Blot: NCOA4 Antibody (1F11) [H00008031-M05] - Analysis of NCOA4 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/Immunofluorescence: NCOA4 Antibody (1F11) [H00008031-M05] - Analysis of monoclonal antibody to NCOA4 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: NCOA4 Antibody (1F11) [H00008031-M05] - Analysis of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TGF-beta 1
[Unconjugated]
7754-BH/CF
TGF-beta 1 [Unconjugated]
(8 Publications)
Species: Hu
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in human duodenum and testis tissues using NBP1-87404 antibody. Corresponding Adenosine Deaminase/ADA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human duodenum, small intestine, stomach and testis using Anti-Adenosine Deaminase/ADA antibody NBP1-87404 (A) shows similar protein distribution across tissues to independent antibody NBP1-90361 (B).
Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Patched 1/PTCH
Antibody
NBP1-71662
Western Blot: Patched 1/PTCH Antibody [NBP1-71662] - Analysis of Patched 1 in human skeletal muscle protein.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
ENPP-2/Autotaxin
[Unconjugated]
5255-EN
ENPP-2/Autotaxin [Unconjugated]
(5 Publications)
Species: Hu
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(27 Publications)
Species: Mu
Applications: WB, IHC
USP9x Antibody
NBP1-48321
Western Blot: USP9x Antibody [NBP1-48321] - WT1 is a substrate of pUSP9X (serine 2563) in mitosis. Co-immunoprecipitation of FLAG-tagged WT1 with endogenous USP9X from HEK 293T cells (EV, expression vector). Cells were exposed to nocodazole, collected, lysed (WCE, whole cell extracts), and subjected to anti-FLAG immunoprecipitation before analysis by western blot. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-020-15059-5), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: USP9x Antibody [NBP1-48321] - Immunocytochemical analysis of USP9X in NTERA-2 cells
Immunohistochemistry: USP9x Antibody [NBP1-48321] - IHC staining of Usp9x in brain tissue.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Nogo Receptor/NgR
Antibody
AF1440
Nogo Receptor/NgR Antibody
(2 Reviews)
(12 Publications)
Species: Mu
Applications: WB
KAP1 [p Ser824]
Antibody
NB100-2350
Western Blot: KAP1 [p Ser824] Antibody [NB100-2350] - MDA-MB-231 cells were treated with DMSO or Merbarone (100 uM) for 24 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. KAP1 [p Ser824] Antibody (NB100-2350) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: KAP1 [p Ser824] Antibody [NB100-2350] - NBF-fixed asynchronous HeLa cells grown in chambered microscope slides and treated with EPE (left) or untreated (right). Antibody: Affinity purified rabbit anti-Phospho KAP-1 (S824) used at a dilution of 1:200 (1ug/ml). Detection: Red fluorescent Anti-rabbit IgG-DyLight (R) 594 conjugated used at a dilution of 1:100.
Immunohistochemistry-Paraffin: KAP1 [p Ser824] Antibody [NB100-2350] - Human Phospho Kap1 (S824) by Immunohistochemistry. Sample: FFPE serial section of human lung cancer used at a dilution of 1:200 (1 ug/ml). Detection: DAB
(1 Review)
(32 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
LOX Antibody
NB100-2527
Western Blot: LOX Antibody [NB100-2527] - LOX secretion and activity in response to tumor cell irradiation. Western blot of LOX zymogen (50 kDa) and active form (32 kDa) in conditioned media derived from irradiated A549 lung carcinoma cells 16-20 h after irradiation and quantification of band intensities from 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-532) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LOX Antibody [NB100-2527] - Expression of Lox and Loxl1-Loxl4 mRNAs in orthotopic rat prostate tumours and in the surrounding normal rat prostate tissue. Representative sections from a 10-day orthotopic AT-1 rat prostate tumour (T), tumour-adjacent normal rat prostate tissue (N), and tumour-free control rat prostate tissue stained for LOX (inserts show LOX staining in higher magnifications). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep19608), licensed under a CC-BY licence.
Simple Western: LOX Antibody [NB100-2527] - Simple Western shows a specific band for LOX in 1.0 mg/ml of HeLa cell lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(5 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
TIF1 gamma
Antibody (6D1)
H00051592-M01
TIF1 gamma Antibody (6D1)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TIF1 gamma Antibody (H00051592-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TIF1 gamma Antibody (H00051592-M01) (0)

There are no reviews for TIF1 gamma Antibody (H00051592-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 gamma Antibody (H00051592-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TIF1 gamma Products

Bioinformatics Tool for TIF1 gamma Antibody (H00051592-M01)

Discover related pathways, diseases and genes to TIF1 gamma Antibody (H00051592-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 gamma Antibody (H00051592-M01)

Discover more about diseases related to TIF1 gamma Antibody (H00051592-M01).
 

Pathways for TIF1 gamma Antibody (H00051592-M01)

View related products by pathway.

PTMs for TIF1 gamma Antibody (H00051592-M01)

Learn more about PTMs related to TIF1 gamma Antibody (H00051592-M01).

Blogs on TIF1 gamma

There are no specific blogs for TIF1 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 gamma Antibody (6D1) and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM33
Entrez
OMIM
Uniprot