TIAM2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TIAM2 Antibody [NBP1-80713] - Staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: TIAM2 Antibody [NBP1-80713] - Staining of human cerebral cortex shows strong positivity in neuropil.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIAM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TIAM2 Antibody - BSA Free (NBP1-80713) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TIAM2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIAM2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TIAM2 Protein (NBP1-80713PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25646088)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TIAM2 Antibody - BSA Free

• FLJ41865
• KIAA2016
• SIF and TIAM1-like exchange factor
• STEFTIAM-2
• T-cell lymphoma invasion and metastasis 2
• T-lymphoma invasion and metastasis-inducing protein 2

Background

TIAM2 encodes a guanine nucleotide exchange factor. A highly similar mouse protein specifically activates ras-related C3 botulinum substrate 1, converting this Rho-like guanosine triphosphatase (GTPase) from a guanosine diphosphate-bound inactive state to a guanosine triphosphate-bound active state. The encoded protein may play a role in neural cell development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIAM2 Antibody (NBP1-80713)(3)

Publications using NBP1-80713

• Lodde V, Garcia Barros R, Terzaghi L et al. Insights on the Role of PGRMC1 in Mitotic and Meiotic Cell Division Cancers 2022-11-23 [PMID: 36497237] (ICC/IF, Bovine)
  
  Details:
  Dilution used 1:100
• Xie Q, Zhang Y, Zhang J et al. Promotion effect of the blend containing 2'-FL, OPN and DHA on oligodendrocyte progenitor cells myelination in vitro Frontiers in nutrition 2022-11-10 [PMID: 36438761] (IF/IHC, Rat)
• Artym VV, Swatkoski S, Matsumoto K et al. Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network. J Cell Biol 2015-02-02 [PMID: 25646088]

Bioinformatics

• Gene Symbol: TIAM2
• Entrez:
  • 26230(Human)