TIAL1 Antibody - BSA Free

Immunohistochemistry: TIAL1 Antibody [NBP3-38225] - Immunohistochemistry analysis of paraffin-embedded Human appendix using TIAL1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: TIAL1 Antibody [NBP3-38225] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using TIAL1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: TIAL1 Antibody [NBP3-38225] - Western blot analysis of various lysates using TIAL1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: TIAL1 Antibody [NBP3-38225] - Immunohistochemistry analysis of paraffin-embedded Rat lung using TIAL1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIAL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TIAL1 Antibody - BSA Free (NBP3-38225) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).
  
  Sequence:
  EGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TIAL1 Antibody - BSA Free

• aging-associated gene 7 protein
• MGC33401
• TCBP
• T-cluster binding protein
• TIA1 cytotoxic granule-associated RNA binding protein-like 1
• TIA1 cytotoxic granule-associated RNA-binding protein-like 1
• TIA-1 related protein
• TIA-1-related nucleolysin
• TIA-1-related protein
• TIARnucleolysin TIAR

Background

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIAL1