TIA1 Antibody

Western Blot: TIA1 Antibody [H00007072-B01P] - Analysis of TIA1 expression in human liver.

Western Blot: TIA1 Antibody [H00007072-B01P] - Analysis of TIA1 expression in transfected 293T cell line by TIA1 polyclonal antibody. Lane 1: TIA1 transfected lysate(23.54 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

TIA1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TIA1 (AAH15944.1, 1 a.a. - 214 a.a.) full-length human protein. MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF
• Specificity: TIA1 - TIA1 cytotoxic granule-associated RNA binding protein,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TIA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIA1 Antibody

• cytotoxic granule-associated RNA-binding protein
• nucleolysin TIA-1 isoform p40
• p40-TIA-1 (containing p15-TIA-1)
• p40-TIA-1
• RNA-binding protein TIA-1
• T-cell-restricted intracellular antigen-1
• TIA1 cytotoxic granule-associated RNA binding protein
• TIA1 cytotoxic granule-associated RNA-binding protein
• TIA-1

Background

The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIA1
• Entrez:
  • 7072(Human)
• Uniprot:
  • AAH15944.1(Human)