Thymosin beta 4 Antibody - BSA Free

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thymosin beta 4 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-44 of human TMSB4X (NP_066932.1). MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMSB4X
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Thymosin beta 4 Antibody - BSA Free

• PTMB4
• T beta-4
• TB4
• TB4X
• TB4Xbeta 4, X chromosome
• THYB4
• Thymosin beta 4
• thymosin beta 4, X-linked
• thymosin beta-4
• TMSB4
• TMSB4X

Background

Thymosin beta 4 encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMSB4X