THSD1 Antibody - BSA Free

Staining of human colon shows shows strong cytoplasmic positivity in endothelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THSD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THSD1 Antibody - BSA Free (NBP3-25189) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein THSD1 using the following amino acid sequence: KSQARHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THSD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for THSD1 Antibody - BSA Free

• thrombospondin type-1 domain-containing protein 1
• thrombospondin, type I, domain 1
• thrombospondin, type I, domain containing 1,4833423O18Rik
• THSD1
• TMTSP
• TMTSPMGC74971
• Transmembrane molecule with thrombospondin module
• UNQ3010

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THSD1