SNX20 Antibody - BSA Free

Western Blot: SNX20 Antibody [NBP1-92418] - Analysis in control (vector only transfected HEK293T lysate) and SNX20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SNX20 Antibody [NBP1-92418] - Staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SNX20 Antibody [NBP1-92418] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts .

Analysis in control (vector only transfected HEK293T lysate) and SNX20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX20 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGCMGPITQCTARTQQEAPATGPDLLHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SNX20 Protein (NBP1-92418PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX20 Antibody - BSA Free

• MGC35578
• selectin ligand interactor cytoplasmic-1
• Selectin ligand-interactor cytoplasmic 1
• SLIC-1
• SLIC1selectin ligand interactor cytoplasmic 1
• sorting nexin 20
• sorting nexin-20

Background

Serves as a sorting protein that cycles P-selectin glycoprotein ligand 1 (PSLG1) into endosomes with no impact on leukocytes recruitement

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNX20