THSD1 Antibody

Images

 
Western Blot: THSD1 Antibody [NBP1-86930] - Analysis in control (vector only transfected HEK293T lysate) and THSD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: THSD1 Antibody [NBP1-86930] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: THSD1 Antibody [NBP1-86930] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THSD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THSD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 28576485). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
THSD1 Protein (NBP1-86930PEP)
Publications
Read Publication using
NBP1-86930 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for THSD1 Antibody

  • thrombospondin type-1 domain-containing protein 1
  • thrombospondin, type I, domain 1
  • thrombospondin, type I, domain containing 1,4833423O18Rik
  • THSD1
  • TMTSP
  • TMTSPMGC74971
  • Transmembrane molecule with thrombospondin module
  • UNQ3010

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DTSP10
Species: Hu
Applications: ELISA
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF1334
Species: Hu
Applications: IHC, WB
AF5510
Species: Hu
Applications: WB
AF756
Species: Mu
Applications: IHC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-12326
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-13780
Species: Hu, Mu
Applications: IHC, IHC-P
H00026531-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-76638
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-85935
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92418
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-31052
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-76639
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4055
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-84222
Species: Hu, Rt
Applications: IHC, IHC-P, WB

Publications for THSD1 Antibody (NBP1-86930)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for THSD1 Antibody (NBP1-86930) (0)

There are no reviews for THSD1 Antibody (NBP1-86930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for THSD1 Antibody (NBP1-86930) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THSD1 Products

Bioinformatics Tool for THSD1 Antibody (NBP1-86930)

Discover related pathways, diseases and genes to THSD1 Antibody (NBP1-86930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THSD1 Antibody (NBP1-86930)

Discover more about diseases related to THSD1 Antibody (NBP1-86930).
 

Pathways for THSD1 Antibody (NBP1-86930)

View related products by pathway.

PTMs for THSD1 Antibody (NBP1-86930)

Learn more about PTMs related to THSD1 Antibody (NBP1-86930).
 

Research Areas for THSD1 Antibody (NBP1-86930)

Find related products by research area.

Blogs on THSD1

There are no specific blogs for THSD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THSD1