Thrombospondin-3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Thrombospondin-3 Antibody [NBP2-68953] - Staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thrombospondin-3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THBS3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Thrombospondin-3 Antibody - BSA Free

• MGC119565
• THBS3
• thrombospondin 3
• Thrombospondin3
• Thrombospondin-3
• TSP3
• TSP3MGC119564

Background

THBS3 is a gene that codes for an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions and has two isoforms, with lengths of 956 and 836 amino acids and weights of approximately 104 and 91 kDa respectively. Current research is being done on diseases and disorders related to this gene including osteosarcoma, lung cancer, breast cancer, retinitis, malaria, neuronitis, and echinococcosis. THBS3 has also been shown to have interactions with THBS2, THBS1, THBS4, FURIN, and PDGFB in pathways such as the focal adhesion, inflammatory response, signal transduction, signaling by PDGF, phagosome, ECM-receptor interaction, and malaria pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THBS3