Thrombospondin-3 Antibody


Immunocytochemistry/ Immunofluorescence: Thrombospondin-3 Antibody [NBP2-68953] - Staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

Thrombospondin-3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for Thrombospondin-3 Antibody

  • MGC119565
  • THBS3
  • thrombospondin 3
  • Thrombospondin3
  • Thrombospondin-3
  • TSP3
  • TSP3MGC119564


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Po, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP

Publications for Thrombospondin-3 Antibody (NBP2-68953) (0)

There are no publications for Thrombospondin-3 Antibody (NBP2-68953).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thrombospondin-3 Antibody (NBP2-68953) (0)

There are no reviews for Thrombospondin-3 Antibody (NBP2-68953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Thrombospondin-3 Antibody (NBP2-68953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Thrombospondin-3 Products

Bioinformatics Tool for Thrombospondin-3 Antibody (NBP2-68953)

Discover related pathways, diseases and genes to Thrombospondin-3 Antibody (NBP2-68953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thrombospondin-3 Antibody (NBP2-68953)

Discover more about diseases related to Thrombospondin-3 Antibody (NBP2-68953).

Pathways for Thrombospondin-3 Antibody (NBP2-68953)

View related products by pathway.

PTMs for Thrombospondin-3 Antibody (NBP2-68953)

Learn more about PTMs related to Thrombospondin-3 Antibody (NBP2-68953).

Blogs on Thrombospondin-3

There are no specific blogs for Thrombospondin-3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Thrombospondin-3 Antibody and receive a gift card or discount.


Gene Symbol THBS3
Novus 100% Guarantee