THAP1 Antibody

Images

 
Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in Jurkat.
Western Blot: THAP1 Antibody [H00055145-D01P] - Analysis of THAP1 expression in transfected 293T cell line by THAP1 polyclonal antibody.Lane 1: THAP1 transfected lysate(24.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THAP1 Antibody Summary

Immunogen
THAP1 (NP_060575.1, 1 a.a. - 213 a.a.) full-length human protein. MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Specificity
THAP1 - THAP domain containing, apoptosis associated protein 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THAP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Immunocytochemistry/Immunofluorescence and Immunohistochemistrywere reported in scientific literature.
Publications
Read Publication using
H00055145-D01P in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for THAP1 Antibody

  • 4833431A01Rik
  • dystonia 6, torsion (autosomal dominant)
  • DYT6
  • FLJ10477
  • MGC33014
  • nuclear proapoptotic factor
  • THAP domain containing, apoptosis associated protein 1
  • THAP domain protein 1
  • THAP domain-containing protein 1

Background

The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NB100-98689
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68210
Species: Hu, Mu
Applications: WB, IP
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-14936
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74624
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for THAP1 Antibody (H00055145-D01P)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for THAP1 Antibody (H00055145-D01P) (0)

There are no reviews for THAP1 Antibody (H00055145-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for THAP1 Antibody (H00055145-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional THAP1 Products

Bioinformatics Tool for THAP1 Antibody (H00055145-D01P)

Discover related pathways, diseases and genes to THAP1 Antibody (H00055145-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THAP1 Antibody (H00055145-D01P)

Discover more about diseases related to THAP1 Antibody (H00055145-D01P).
 

Pathways for THAP1 Antibody (H00055145-D01P)

View related products by pathway.

Blogs on THAP1

There are no specific blogs for THAP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THAP1
Entrez
Uniprot