TGN46 Recombinant Protein Antigen

Images

 
There are currently no images for TGN46 Protein (NBP1-86948PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TGN46 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGOLN2.

Source: E. coli

Amino Acid Sequence: KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TGOLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86948.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TGN46 Recombinant Protein Antigen

  • TGN 46
  • TGN 48
  • TGN 51
  • TGN38 homolog
  • TGN38
  • TGN-38
  • TGN46
  • TGN-46
  • TGN48
  • TGN51
  • TGOLN 2
  • TGOLN2
  • trans golgi network 38
  • trans golgi network 46
  • Trans Golgi network integral membrane protein 2 [Precursor]
  • Trans Golgi network integral membrane protein 2
  • Trans Golgi network protein (46 48 51kD isoforms)
  • Trans golgi network protein 2
  • Trans Golgi network protein TGN51
  • Trans-Golgi network integral membrane protein 2
  • Trans-Golgi network protein 2
  • Trans-Golgi network protein TGN51
  • TTGN 2
  • TTGN2

Background

The Trans-Golgi network integral membrane protein 2 (TGOLN2) was designated TGN46 based on the predicted molecular mass (46kDa). However, TGN46 is a heavily glycosylated protein, so its molecular weight is often detected at a 110-120kDa. The TGN46 protein is widely expressed. It may be involved in regulating membrane traffic to and from trans-Golgi network, and has been reported as the best available marker for human trans-Golgi network. TGN46 contains a luminal domain, a membrane-spanning domain, and a cytoplasmic domain. The membrane-spanning and cytoplasmic domains contain the retention and retrieval signals, respectively, for localization in the TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1903
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
2914-HT
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-04024
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38528
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NBP2-92832
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86948PEP
Species: Hu
Applications: AC

Publications for TGN46 Protein (NBP1-86948PEP) (0)

There are no publications for TGN46 Protein (NBP1-86948PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGN46 Protein (NBP1-86948PEP) (0)

There are no reviews for TGN46 Protein (NBP1-86948PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TGN46 Protein (NBP1-86948PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGN46 Products

Research Areas for TGN46 Protein (NBP1-86948PEP)

Find related products by research area.

Blogs on TGN46

There are no specific blogs for TGN46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TGN46 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TGOLN2