We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human TGN46 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human TGN46 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 229-327 of Human TGN46

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TGOLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TGN46 GST (N-Term) Protein

  • TGN 46
  • TGN 48
  • TGN 51
  • TGN38 homolog
  • TGN38
  • TGN-38
  • TGN46
  • TGN-46
  • TGN48
  • TGN51
  • TGOLN 2
  • TGOLN2
  • trans golgi network 38
  • trans golgi network 46
  • Trans Golgi network integral membrane protein 2 [Precursor]
  • Trans Golgi network integral membrane protein 2
  • Trans Golgi network protein (46 48 51kD isoforms)
  • Trans golgi network protein 2
  • Trans Golgi network protein TGN51
  • Trans-Golgi network integral membrane protein 2
  • Trans-Golgi network protein 2
  • Trans-Golgi network protein TGN51
  • TTGN 2
  • TTGN2

Background

The Trans-Golgi network integral membrane protein 2 (TGOLN2) was designated TGN46 based on the predicted molecular mass (46kDa). However, TGN46 is a heavily glycosylated protein, so its molecular weight is often detected at a 110-120kDa. The TGN46 protein is widely expressed. It may be involved in regulating membrane traffic to and from trans-Golgi network, and has been reported as the best available marker for human trans-Golgi network. TGN46 contains a luminal domain, a membrane-spanning domain, and a cytoplasmic domain. The membrane-spanning and cytoplasmic domains contain the retention and retrieval signals, respectively, for localization in the TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-1903
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
2914-HT
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-04024
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38528
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP2-92832
Species: Hu, Mu
Applications: ICC/IF, WB
H00010618-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for TGN46 Partial Recombinant Protein (H00010618-Q01) (0)

There are no publications for TGN46 Partial Recombinant Protein (H00010618-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGN46 Partial Recombinant Protein (H00010618-Q01) (0)

There are no reviews for TGN46 Partial Recombinant Protein (H00010618-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TGN46 Partial Recombinant Protein (H00010618-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGN46 Products

Research Areas for TGN46 Partial Recombinant Protein (H00010618-Q01)

Find related products by research area.

Blogs on TGN46

There are no specific blogs for TGN46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TGN46 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TGOLN2