TGN46 Antibody (2F11) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse TGN46 Antibody (2F11) - Azide and BSA Free (H00010618-M02) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-TGN46 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE |
| Marker |
TGN Marker |
| Specificity |
TOGLN2 (2F11) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TGOLN2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:500
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TGN46 Antibody (2F11) - Azide and BSA Free
Background
The trans-Golgi network (TGN) is part of the secretory pathway of eukaryotic cells which is distinct from the Golgi stack. The TGN is important in the later stages of protein secretion where it seems to play a key role in the sorting and targeting of secreted proteins to the correct destination. Some surface receptors recycle between the cell surface and the TGN, suggesting that the TGN is also important in endocytic pathways. TGN46 cycles between the trans-Golgi network and the cell surface returning via endosomes. It is thought to be involved in regulating membrane traffic to and from trans-Golgi network. Three splice isoforms are exist, TGN46, TGN48 and TGN51. Isoform TGN46 is the more widely expressed isoform. TGN48 is expressed in embryonic kidney and promyelocytic cells. Isoform TGN51 is abundant in fetal lung and kidney. TGN46 is a human specific protein. The rodent homologue of TGN46 is known as TGN38.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC
Publications for TGN46 Antibody (H00010618-M02)(7)
Showing Publications 1 -
7 of 7.
| Publications using H00010618-M02 |
Applications |
Species |
| Charles AS, Chouljenko VN, Jambunathan N et al. Phenylalanine Residues at the Carboxyl-terminus of the Herpes Simplex Virus Type-1 UL20 Membrane Protein Regulate Cytoplasmic Virion Envelopment and Infectious Virus Production. J Virol. 2014-04-23 [PMID: 24760889] |
|
|
| Yoshida K, Asakawa M, Suzuki-Kouyama E et al. Distinctive features of degenerating Purkinje cells in spinocerebellar ataxia type 31. Neuropathology. 2013-12-17 [PMID: 24344778] |
|
|
| Higashi S, Iseki E, Minegishi M et al. GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. J Neurochem. 2010-07-28 [PMID: 20670374] |
|
|
| Lee J, Hwang H, Kang D et al. Therapy-induced senescent cancer cells contribute to cancer recurrence by providing a PD-L1 umbrella regulated by ribophorin 1 Research Square 2023-10-09 |
|
|
| Barr AR, Kilmartin JV, Gergely F et al. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. J Cell Biol 2010-04-01 [PMID: 20368616] |
|
|
| Higashi S, Moore DJ, Yamamoto R et al. Abnormal localization of leucine-rich repeat kinase 2 to the endosomal-lysosomal compartment in lewy body disease. J Neuropathol Exp Neurol 68(9):994-1005. 2009-09-01 [PMID: 19680143] |
|
|
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
|
|
Reviews for TGN46 Antibody (H00010618-M02) (0)
There are no reviews for TGN46 Antibody (H00010618-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TGN46 Antibody (H00010618-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TGN46 Products
Research Areas for TGN46 Antibody (H00010618-M02)
Find related products by research area.
|
Blogs on TGN46