TGN46 Antibody (2F11)

Images

 
Immunocytochemistry/ Immunofluorescence: TGN46 Antibody (2F11) [H00010618-M02] - Analysis of monoclonal antibody to TGOLN2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TGN46 Antibody (2F11) [H00010618-M02] - Analysis of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
ELISA: TGN46 Antibody (2F11) [H00010618-M02] - Detection limit for recombinant GST tagged TGOLN2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TGN46 Antibody (2F11) Summary

Immunogen
TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Marker
TGN Marker
Specificity
TOGLN2 (2F11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TGOLN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00010618-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TGN46 Antibody (2F11)

  • TGN 46
  • TGN 48
  • TGN 51
  • TGN38 homolog
  • TGN38
  • TGN-38
  • TGN46
  • TGN-46
  • TGN48
  • TGN51
  • TGOLN 2
  • TGOLN2
  • trans golgi network 38
  • trans golgi network 46
  • Trans Golgi network integral membrane protein 2 [Precursor]
  • Trans Golgi network integral membrane protein 2
  • Trans Golgi network protein (46 48 51kD isoforms)
  • Trans golgi network protein 2
  • Trans Golgi network protein TGN51
  • Trans-Golgi network integral membrane protein 2
  • Trans-Golgi network protein 2
  • Trans-Golgi network protein TGN51
  • TTGN 2
  • TTGN2

Background

The trans-Golgi network (TGN) is part of the secretory pathway of eukaryotic cells which is distinct from the Golgi stack. The TGN is important in the later stages of protein secretion where it seems to play a key role in the sorting and targeting of secreted proteins to the correct destination. Some surface receptors recycle between the cell surface and the TGN, suggesting that the TGN is also important in endocytic pathways. TGN46 cycles between the trans-Golgi network and the cell surface returning via endosomes. It is thought to be involved in regulating membrane traffic to and from trans-Golgi network. Three splice isoforms are exist, TGN46, TGN48 and TGN51. Isoform TGN46 is the more widely expressed isoform. TGN48 is expressed in embryonic kidney and promyelocytic cells. Isoform TGN51 is abundant in fetal lung and kidney. TGN46 is a human specific protein. The rodent homologue of TGN46 is known as TGN38.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-53420
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04024
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-36568
Species: Hu, Mu, V-Vi
Applications: WB, IHC, IHC-P, Flow-IC

Publications for TGN46 Antibody (H00010618-M02)(6)

Reviews for TGN46 Antibody (H00010618-M02) (0)

There are no reviews for TGN46 Antibody (H00010618-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TGN46 Antibody (H00010618-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TGN46 Products

Array H00010618-M02

Bioinformatics Tool for TGN46 Antibody (H00010618-M02)

Discover related pathways, diseases and genes to TGN46 Antibody (H00010618-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGN46 Antibody (H00010618-M02)

Discover more about diseases related to TGN46 Antibody (H00010618-M02).
 

Pathways for TGN46 Antibody (H00010618-M02)

View related products by pathway.

PTMs for TGN46 Antibody (H00010618-M02)

Learn more about PTMs related to TGN46 Antibody (H00010618-M02).
 

Research Areas for TGN46 Antibody (H00010618-M02)

Find related products by research area.

Blogs on TGN46

There are no specific blogs for TGN46, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TGN46 Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TGOLN2
Entrez
OMIM
Uniprot