TGF-beta RIII Recombinant Protein Antigen

Images

 
There are currently no images for TGF-beta RIII Protein (NBP1-89988PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TGF-beta RIII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGFBR3.

Source: E. coli

Amino Acid Sequence: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TGFBR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89988.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TGF-beta RIII Recombinant Protein Antigen

  • betaglycan proteoglycan
  • Betaglycan
  • BGCAN
  • TBRIII
  • TGF-beta receptor type 3
  • TGF-beta receptor type III
  • TGF-beta RIII
  • TGFbetaRIII
  • TGFBR3
  • TGF-bRIII
  • TGFR-3
  • Transforming growth factor beta receptor III
  • transforming growth factor beta receptor type 3
  • transforming growth factor, beta receptor III (betaglycan, 300kDa)
  • transforming growth factor, beta receptor III

Background

Transforming growth factor (TGF)-beta is a multifunctional cytokine that modulates several tissue development and repair processes, including cell differentiation, cell cycle progression, cellular migration, adhesion, and extracellular matrix production. Three TGF-beta forms are encoded by separate genes: TGFB1 (MIM 190180), TGFB2 (MIM 190220), and TGFB3 (MIM 190230). The diverse effects of TGF-beta are mediated by the TGF-beta receptors and cell surface-binding proteins. Three TGF-beta receptors exist: type I (TGFBR1; MIM 190181), type II (TFGBR2; MIM 190182), and type III (TGFBR3). TGFBR3 is a glycoprotein that binds TGFB and exists in both a membrane-bound and a soluble form (Johnson et al., 1995 [PubMed 8530052]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3025
Species: Hu
Applications: ELISA, ICC, WB
7754-BH/CF
Species: Hu
Applications: BA
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
302-B2
Species: Hu
Applications: BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
7754-BH/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
233-FB
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF637
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
243-B3
Species: Hu
Applications: BA
NBP1-89988PEP
Species: Hu
Applications: AC

Publications for TGF-beta RIII Protein (NBP1-89988PEP) (0)

There are no publications for TGF-beta RIII Protein (NBP1-89988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGF-beta RIII Protein (NBP1-89988PEP) (0)

There are no reviews for TGF-beta RIII Protein (NBP1-89988PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TGF-beta RIII Protein (NBP1-89988PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGF-beta RIII Products

Research Areas for TGF-beta RIII Protein (NBP1-89988PEP)

Find related products by research area.

Blogs on TGF-beta RIII.

TGF-beta RIII - a high affinity reservoir for TGF-beta I/II ligands with therapeutic potential
TGF beta (transforming growth factor beta) is a superfamily of cytokines that participate in a variety of cellular processes including growth, proliferation, differentiation, and apoptosis. There are 3 classes of receptors for TGF beta cytokines an...  Read full blog post.

TGF-beta RIII - A multi-functional regulator of the TGF-beta signaling pathway
Transforming growth factor-beta receptor III (TGF-beta RIII) is one of three receptors for the secreted growth factor TGF-beta. Unlike type I and type II TGF-beta receptors, TGF-beta RIII does not participate directly in the propagation of intracel...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TGF-beta RIII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TGFBR3