TGF-beta RIII Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TGF-beta RIII Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGFBR3.
  
  

  Source: E. coli

  Amino Acid Sequence: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TGFBR3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89988.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TGF-beta RIII Recombinant Protein Antigen

• betaglycan proteoglycan
• Betaglycan
• BGCAN
• TBRIII
• TGF-beta receptor type 3
• TGF-beta receptor type III
• TGF-beta RIII
• TGFbetaRIII
• TGFBR3
• TGF-bRIII
• TGFR-3
• Transforming growth factor beta receptor III
• transforming growth factor beta receptor type 3
• transforming growth factor, beta receptor III (betaglycan, 300kDa)
• transforming growth factor, beta receptor III

Background

Transforming growth factor (TGF)-beta is a multifunctional cytokine that modulates several tissue development and repair processes, including cell differentiation, cell cycle progression, cellular migration, adhesion, and extracellular matrix production. Three TGF-beta forms are encoded by separate genes: TGFB1 (MIM 190180), TGFB2 (MIM 190220), and TGFB3 (MIM 190230). The diverse effects of TGF-beta are mediated by the TGF-beta receptors and cell surface-binding proteins. Three TGF-beta receptors exist: type I (TGFBR1; MIM 190181), type II (TFGBR2; MIM 190182), and type III (TGFBR3). TGFBR3 is a glycoprotein that binds TGFB and exists in both a membrane-bound and a soluble form (Johnson et al., 1995 [PubMed 8530052]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TGFBR3