TfR (Transferrin R) Antibody - BSA Free

Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human placenta and pancreas tissues. Corresponding TfR (Transferrin R) RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cell line U-251 MG shows localization to endosomes and lysosomes. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Analysis in human cell line HEL.

Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TfR (Transferrin R) Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TfR (Transferrin R) Antibody - BSA Free (NBP1-85741) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TfR (Transferrin R) Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV
• Marker: Recycling Endosome Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFRC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TfR (Transferrin R) Antibody - BSA Free

• CD71 antigen
• CD71
• CD71TRFR
• p90
• T9
• TfR (Transferrin R)
• TfR (TransferrinR)
• TfR
• TFR1
• TFRC
• TR
• transferrin receptor (p90, CD71)
• transferrin receptor protein 1
• TRFR

Background

Useful in studies of dividing haematopoietic and tumour cell populations, and metabolic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TfR (Transferrin R) Antibody (NBP1-85741)(3)

Publications using NBP1-85741

• Anatoli Y. Kabakov, Karim Roder, Peter Bronk, Nilüfer N. Turan, Saroj Dhakal, Mingwang Zhong, Yichun Lu, Zachary A. Zeltzer, Yonatan B. Najman-Licht, Alain Karma, Gideon Koren E3 ubiquitin ligase rififylin has yin and yang effects on rabbit cardiac transient outward potassium currents ( I to ) and corresponding channel proteins The Journal of Biological Chemistry 2024-02-15 [PMID: 38367666]
• Ta H, Keller J, Haltmeier M et al. Mapping molecules in scanning far-field fluorescence nanoscopy. Nat Commun 2015-08-13 [PMID: 26269133] (WB, Human)
• Lenarduzzi M, Hui AB, Yue S et al. Hemochromatosis Enhances Tumor Progression via Upregulation of Intracellular Iron in Head and Neck Cancer. PLoS One. 2013-08-26 [PMID: 23991213]

Bioinformatics

• Gene Symbol: TFRC