TfR (Transferrin R) Antibody

Images

 
Western Blot: TfR (Transferrin R) Antibody [NBP1-85741] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cell line U-251 MG shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunocytochemistry/ Immunofluorescence: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human cell line U-251 MG shows positivity in vesicles.
Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody [NBP1-85741] - Staining of human kidney shows distinct cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TfR (Transferrin R) Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV
Marker
Recycling Endosome Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFRC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TfR (Transferrin R) Protein (NBP1-85741PEP)
Publications
Read Publications using
NBP1-85741 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23991213)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TfR (Transferrin R) Antibody

  • CD71 antigen
  • CD71
  • CD71TRFR
  • p90
  • T9
  • TfR (Transferrin R)
  • TfR (TransferrinR)
  • TfR
  • TFR1
  • TFRC
  • TR
  • transferrin receptor (p90, CD71)
  • transferrin receptor protein 1
  • TRFR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for TfR (Transferrin R) Antibody (NBP1-85741)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TfR (Transferrin R) Antibody (NBP1-85741) (0)

There are no reviews for TfR (Transferrin R) Antibody (NBP1-85741). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TfR (Transferrin R) Antibody (NBP1-85741) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TfR (Transferrin R) Products

Bioinformatics Tool for TfR (Transferrin R) Antibody (NBP1-85741)

Discover related pathways, diseases and genes to TfR (Transferrin R) Antibody (NBP1-85741). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TfR (Transferrin R) Antibody (NBP1-85741)

Discover more about diseases related to TfR (Transferrin R) Antibody (NBP1-85741).
 

Pathways for TfR (Transferrin R) Antibody (NBP1-85741)

View related products by pathway.

PTMs for TfR (Transferrin R) Antibody (NBP1-85741)

Learn more about PTMs related to TfR (Transferrin R) Antibody (NBP1-85741).
 

Research Areas for TfR (Transferrin R) Antibody (NBP1-85741)

Find related products by research area.

Blogs on TfR (Transferrin R).

Transferrin and the blood brain barrier
Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TfR (Transferrin R) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFRC
Entrez