TFIIB Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFG |
| Predicted Species |
Mouse (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GTF2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TFIIB Antibody - BSA Free
Background
TFIIB encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, ChIP, Mycoplasma
Publications for TFIIB Antibody (NBP2-34143) (0)
There are no publications for TFIIB Antibody (NBP2-34143).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TFIIB Antibody (NBP2-34143) (0)
There are no reviews for TFIIB Antibody (NBP2-34143).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TFIIB Antibody (NBP2-34143) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TFIIB Products
Research Areas for TFIIB Antibody (NBP2-34143)
Find related products by research area.
|
Blogs on TFIIB