TFEC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TFEC Antibody [NBP2-57258] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFEC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFEC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TFEC Recombinant Protein Antigen (NBP2-57258PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFEC Antibody - BSA Free

• Class E basic helix-loop-helix protein 34
• hTFEC-L
• TCFECTFECLbHLHe34BHLHE34
• TFE-C
• transcription factor EC
• Transcription factor EC-like

Background

Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter . Collaborates with MITF in target gene activation . Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence . Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer . Binds DNA in a homo- or heterodimeric form

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFEC