Recombinant Human TET1 GST (N-Term) Protein

SDS-Page: Recombinant Human TET1 Protein [H00080312-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human TET1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2038-2136 of Human TET1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: TET1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TET1 GST (N-Term) Protein

• bA119F7.1
• CXXC finger 6
• CXXC6
• CXXC6FLJ10839
• EC 1.14.11.n2
• FLJ41442
• KIAA1676
• KIAA1676CXXC-type zinc finger protein 6
• LCX
• LCXEC 1.14.11.n2
• Leukemia-associated protein with a CXXC domain
• methylcytosine dioxygenase TET1
• Ten-eleven translocation 1 gene protein
• ten-eleven translocation-1
• tet oncogene 1
• TET1

Background

TET1 (Ten-eleven translocation 1), also called methylcytosine dioxygenase TET1 or CXXC6, is one of three members of the human TET protein family of alpha-ketoglutarate oxygenases which includes TET2 and TET3 (1-3). TET1 is an enzyme that plays a role in epigenetic regulation of DNA methylation by conversion of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC), and further to 5-formylcystosine (5fC) and 5-carboxylcystosine (5caC) (1-5). The human TET1 protein is 2136 amino acids in length with a theoretical molecular weight of 235 kDa (6). Primary features of the TET1 protein include an N-terminal CXXC domain responsible for binding CpG islands in DNA, and a C-terminal catalytic domain containing a Cys-rich region followed by a double-stranded beta-helix (DSBH) domain that contributes to the mC dioxygenase activity and metal binding (1,2,4,5).

Recent studies have shown a role for TET1 in mediating epigenetic changes, such as DNA methylation status, in response to environmental factors such as food and nutrition, exercise, radiation, and allergens (3). The balance between DNA methylation and demethylation is crucial in health and homeostasis (3,5). In addition to response to environmental exposures, TET1 also plays a role in different diseases and cancer subtypes where it can function as either a tumor suppressor or tumor promoter (2,5). TET1 was originally identified as a fusion partner for the mixed lineage leukemia (MLL) gene in acute myeloid leukemia (AML) (1-3). While TET1 expression is low in AML, it is highly expressed in T-cell acute lymphoblastic leukemia (T-ALL) (2). Similarly, TET1 expression is suppressed in hormone receptor positive breast cancer (HRBC) but elevated in triple negative breast cancer (2). TET1 is a potential therapeutic target in certain cancers, but due to its complex role in different signaling pathways its potential needs to be more widely studied (2). While TET1 is primarily responsible for initiating DNA demethylation, it also functions alongside 5hmc in maintaining pluripotency in embryonic stem cells (ESCs) and can serve as a marker for differentiation (1,2,4,5).

References

1. Tan L, Shi YG. Tet family proteins and 5-hydroxymethylcytosine in development and disease. Development. 2012;139(11):1895-1902. https://doi.org/10.1242/dev.070771

2. Liu W, Wu G, Xiong F, Chen Y. Advances in the DNA methylation hydroxylase TET1. Biomark Res. 2021;9(1):76. https://doi.org/10.1186/s40364-021-00331-7

3. Zhu T, Brown AP, Ji H. The Emerging Role of Ten-Eleven Translocation 1 in Epigenetic Responses to Environmental Exposures. Epigenet Insights. 2020;13:2516865720910155. https://doi.org/10.1177/2516865720910155

4. Melamed P, Yosefzon Y, David C, Tsukerman A, Pnueli L. Tet Enzymes, Variants, and Differential Effects on Function. Front Cell Dev Biol. 2018;6:22. https://doi.org/10.3389/fcell.2018.00022

5. Ma C, Seong H, Liu Y, Yu X, Xu S, Li Y. Ten-eleven translocation proteins (TETs): tumor suppressors or tumor enhancers?. Front Biosci (Landmark Ed). 2021;26(10):895-915. https://doi.org/10.52586/4996

6. Uniprot (Q8NFU7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TET1