TERF2IP Antibody

Product Discontinued

TERF2IP Antibody Summary

• Immunogen: Synthetic peptides corresponding to TERF2IP(telomeric repeat binding factor 2, interacting protein) The peptide sequence was selected from the middle region of TERF2IP. Peptide sequence EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Rabbit (93%), Guinea Pig (93%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TERF2IP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against TERF2IP and was validated on Western blot.
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TERF2IP Antibody

• dopamine receptor interacting protein 5
• Dopamine receptor-interacting protein 5
• DRIP5
• hRap1
• RAP1 homolog
• RAP1TERF2-interacting telomeric protein 1
• Repressor/activator protein 1 homolog
• telomeric repeat binding factor 2, interacting protein
• telomeric repeat-binding factor 2-interacting protein 1
• TRF2-interacting telomeric protein 1
• TRF2-interacting telomeric RAP1 protein

Background

The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TERF2IP
• Uniprot:
  • Q9NYB0(Human)