TEM7/PLXDC1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLXDC1. Source: E. coli
Amino Acid Sequence: RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PLXDC1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86954. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TEM7/PLXDC1 Recombinant Protein Antigen
Background
Recently, using SAGE (Serial Analysis of Gene Expression) technology, St. Croix et al, have identified 46 genes, whose expression is specifically elevated in tumor-associated endothelium. Nine of these genes were prominently expressed only in tumor endothelial cells (EC), but were absent or barely detectable in normal ECs, and named as Tumor Endothelial Markers (TEMs, TEM 1-9). TEM7 (Tumor endothelial marker 7) transcripts are specifically expressed in the endothelium of colorectal cancer, primary cancers of lung, pancreas, breast, and brain. TEM7 is expressed specifically in endothelium of these cancers, whether primary or metastasis. The other six members of this family (TEM1, 3, 4, 5, 8, and 9) also show similar expression pattern in lung and brain tumors, and liver metastasis. Since most of the genes expressed differentially in tumor endothelium are also expressed during angiogenesis, these newly discovered genes might provide important resources for basic and clinical studies of human angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: AC
Publications for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)
There are no publications for TEM7/PLXDC1 Protein (NBP1-86954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)
There are no reviews for TEM7/PLXDC1 Protein (NBP1-86954PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)
Additional TEM7/PLXDC1 Products
Research Areas for TEM7/PLXDC1 Protein (NBP1-86954PEP)
Find related products by research area.
|
Blogs on TEM7/PLXDC1