TEM7/PLXDC1 Recombinant Protein Antigen

Images

 
There are currently no images for TEM7/PLXDC1 Protein (NBP1-86954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TEM7/PLXDC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLXDC1.

Source: E. coli

Amino Acid Sequence: RSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGTPVHLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLXDC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86954.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TEM7/PLXDC1 Recombinant Protein Antigen

  • FLJ45632
  • plexin domain containing 1,2410003I07Rik
  • plexin domain-containing protein 1
  • PLXDC1
  • TEM3
  • TEM3FLJ36270
  • TEM7
  • TEM7DKFZp686F0937
  • Tumor endothelial marker 3
  • Tumor endothelial marker 7

Background

Recently, using SAGE (Serial Analysis of Gene Expression) technology, St. Croix et al, have identified 46 genes, whose expression is specifically elevated in tumor-associated endothelium. Nine of these genes were prominently expressed only in tumor endothelial cells (EC), but were absent or barely detectable in normal ECs, and named as Tumor Endothelial Markers (TEMs, TEM 1-9). TEM7 (Tumor endothelial marker 7) transcripts are specifically expressed in the endothelium of colorectal cancer, primary cancers of lung, pancreas, breast, and brain. TEM7 is expressed specifically in endothelium of these cancers, whether primary or metastasis. The other six members of this family (TEM1, 3, 4, 5, 8, and 9) also show similar expression pattern in lung and brain tumors, and liver metastasis. Since most of the genes expressed differentially in tumor endothelium are also expressed during angiogenesis, these newly discovered genes might provide important resources for basic and clinical studies of human angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4117
Species: Rt
Applications: IHC, WB
NBP1-76858
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77310
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NB100-65543
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
NBP1-59786
Species: Hu
Applications: WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
AF640
Species: Mu
Applications: IHC, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
AF2570
Species: Hu
Applications: IHC, WB
NBP2-61889
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-86954PEP
Species: Hu
Applications: AC

Publications for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)

There are no publications for TEM7/PLXDC1 Protein (NBP1-86954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)

There are no reviews for TEM7/PLXDC1 Protein (NBP1-86954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TEM7/PLXDC1 Protein (NBP1-86954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEM7/PLXDC1 Products

Research Areas for TEM7/PLXDC1 Protein (NBP1-86954PEP)

Find related products by research area.

Blogs on TEM7/PLXDC1

There are no specific blogs for TEM7/PLXDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TEM7/PLXDC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLXDC1