TEM5/GPR124 Antibody - BSA Free

Staining of human cell line SH-SY5Y shows localization to plasma membrane & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TEM5/GPR124 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein TEM5/GPR124 using the following amino acid sequence: LLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TEM5/GPR124 Antibody - BSA Free

• DKFZp434C211
• DKFZp434J0911
• G protein-coupled receptor 124
• GPR124
• G-protein coupled receptor 124
• KIAA1531
• KIAA1531FLJ14390
• TEM5
• TEM5Tumor endothelial marker 5

Background

Tumor endothelial marker 5 is an Orphan-U GPCR with an unknown ligand. Tumor Endothelial Marker 5, like GPR125, has a leucine rich repeat (LRR), an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain shows similarities to motilin and titin, while the LRR domain shows similarities to LRIG1 and SLIT1-2. ESTs have been isolated primarily from amnion, connective tissue, ear, embryo, eye, ganglion, heart, lung, placenta, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRA2