TEF1 Antibody

Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Mouse heart using TEAD1 Rabbit pAb at dilution of 1:100 (40x lens).

Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Rat brain using TEAD1 Rabbit pAb at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Human placenta using TEAD1 Rabbit pAb at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TEF1 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEF1 (NP_068780.2). APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 1:20-1:50
  • Immunocytochemistry/Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TEF1 Antibody

• NTEF-1
• Protein GT-IIC
• TCF13
• TCF-13
• TEA domain family member 1 (SV40 transcriptional enhancer factor)
• TEAD1
• TEAD-1
• TEF1

Background

TEF1 binds specifically and cooperatively to the SPH and GT IIC quot enhansons quot; (GTGGAATGT) and activates transcription in vivo in a cell specific manner. The activation function appears to be mediated by a limiting cell specific transcriptional intermediary factor (TIF). It is involved in cardiac development and also binds to the MCAT motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD1