TEF1 Antibody

Images

 
Western Blot: TEF1 Antibody [NBP2-56713] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: TEF1 Antibody [NBP2-56713] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Specificity
Specificity of human TEF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEAD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TEF1 Antibody

  • NTEF-1
  • protein GT-IIC
  • TEA domain family member 1 (SV40 transcriptional enhancer factor)
  • TEAD-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
H00008398-D01P
Species: Hu, Mu
Applications: WB
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6659
Species: Hu, Mu
Applications: WB, IHC
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TEF1 Antibody (NBP2-56713) (0)

There are no publications for TEF1 Antibody (NBP2-56713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEF1 Antibody (NBP2-56713) (0)

There are no reviews for TEF1 Antibody (NBP2-56713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TEF1 Antibody (NBP2-56713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TEF1 Products

Bioinformatics Tool for TEF1 Antibody (NBP2-56713)

Discover related pathways, diseases and genes to TEF1 Antibody (NBP2-56713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEF1 Antibody (NBP2-56713)

Discover more about diseases related to TEF1 Antibody (NBP2-56713).
 

Pathways for TEF1 Antibody (NBP2-56713)

View related products by pathway.

PTMs for TEF1 Antibody (NBP2-56713)

Learn more about PTMs related to TEF1 Antibody (NBP2-56713).

Blogs on TEF1

There are no specific blogs for TEF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD1