TEF1 Antibody


Immunocytochemistry/ Immunofluorescence: TEF1 Antibody [NBP2-56713] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

TEF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TEF1 Recombinant Protein Antigen (NBP2-56713PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TEF1 Antibody

  • NTEF-1
  • Protein GT-IIC
  • TCF13
  • TCF-13
  • TEA domain family member 1 (SV40 transcriptional enhancer factor)
  • TEAD1
  • TEAD-1
  • TEF1


TEF1 binds specifically and cooperatively to the SPH and GT IIC quot enhansons quot; (GTGGAATGT) and activates transcription in vivo in a cell specific manner. The activation function appears to be mediated by a limiting cell specific transcriptional intermediary factor (TIF). It is involved in cardiac development and also binds to the MCAT motif.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for TEF1 Antibody (NBP2-56713) (0)

There are no publications for TEF1 Antibody (NBP2-56713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEF1 Antibody (NBP2-56713) (0)

There are no reviews for TEF1 Antibody (NBP2-56713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TEF1 Antibody (NBP2-56713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TEF1 Products

Array NBP2-56713

Bioinformatics Tool for TEF1 Antibody (NBP2-56713)

Discover related pathways, diseases and genes to TEF1 Antibody (NBP2-56713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEF1 Antibody (NBP2-56713)

Discover more about diseases related to TEF1 Antibody (NBP2-56713).

Pathways for TEF1 Antibody (NBP2-56713)

View related products by pathway.

PTMs for TEF1 Antibody (NBP2-56713)

Learn more about PTMs related to TEF1 Antibody (NBP2-56713).

Research Areas for TEF1 Antibody (NBP2-56713)

Find related products by research area.

Blogs on TEF1.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TEF1 Antibody and receive a gift card or discount.


Gene Symbol TEAD1