Teashirt homolog 1 Recombinant Protein Antigen

Images

 
There are currently no images for Teashirt homolog 1 Protein (NBP1-87377PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Teashirt homolog 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSHZ1.

Source: E.coli

Amino Acid Sequence: YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TSHZ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87377.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Teashirt homolog 1 Recombinant Protein Antigen

  • Antigen NY-CO-33
  • NY-CO-33
  • SDCCAG33
  • Serologically defined colon cancer antigen 33teashirt family zinc finger 1
  • teashirt homolog 1
  • teashirt zinc finger homeobox 1
  • TSH1teashirt zinc finger 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
NB200-527
Species: Hu, Mu, Rt
Applications: WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-42864
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38142
Species: Hu
Applications: WB, IHC, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP
NB100-56681
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Teashirt homolog 1 Protein (NBP1-87377PEP) (0)

There are no publications for Teashirt homolog 1 Protein (NBP1-87377PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Teashirt homolog 1 Protein (NBP1-87377PEP) (0)

There are no reviews for Teashirt homolog 1 Protein (NBP1-87377PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Teashirt homolog 1 Protein (NBP1-87377PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Teashirt homolog 1 Products

Bioinformatics Tool for Teashirt homolog 1 Protein (NBP1-87377PEP)

Discover related pathways, diseases and genes to Teashirt homolog 1 Protein (NBP1-87377PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Teashirt homolog 1 Protein (NBP1-87377PEP)

Discover more about diseases related to Teashirt homolog 1 Protein (NBP1-87377PEP).
 

Pathways for Teashirt homolog 1 Protein (NBP1-87377PEP)

View related products by pathway.

PTMs for Teashirt homolog 1 Protein (NBP1-87377PEP)

Learn more about PTMs related to Teashirt homolog 1 Protein (NBP1-87377PEP).

Blogs on Teashirt homolog 1

There are no specific blogs for Teashirt homolog 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Teashirt homolog 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHZ1