Recombinant Human Teashirt homolog 1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Teashirt homolog 1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 619-717 of Human Teashirt homolog 1

Source: Wheat Germ

Amino Acid Sequence: SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TSHZ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Teashirt homolog 1 Protein

  • Antigen NY-CO-33
  • NY-CO-33
  • SDCCAG33
  • Serologically defined colon cancer antigen 33teashirt family zinc finger 1
  • teashirt homolog 1
  • teashirt zinc finger homeobox 1
  • TSH1teashirt zinc finger 1

Background

SDCCAG33 - serologically defined colon cancer antigen 33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB200-527
Species: Hu, Mu
Applications: WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38142
Species: Hu
Applications: WB, IHC, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01) (0)

There are no publications for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01) (0)

There are no reviews for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Teashirt homolog 1 Products

Bioinformatics Tool for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01)

Discover related pathways, diseases and genes to Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01)

Discover more about diseases related to Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01).
 

Pathways for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01)

View related products by pathway.

PTMs for Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01)

Learn more about PTMs related to Teashirt homolog 1 Partial Recombinant Protein (H00010194-Q01).

Blogs on Teashirt homolog 1

There are no specific blogs for Teashirt homolog 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Teashirt homolog 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHZ1