TEAD4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TEAD4 Antibody [NBP2-33803] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TEAD4 Antibody [NBP2-33803] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

ChIP-Exo-Seq composite graph for Anti-TEAD4 (NBP2-33803) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TEAD4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TEAD4 Antibody - BSA Free (NBP2-33803) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TEAD4 Protein (NBP2-33803PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TEAD4 Antibody - BSA Free

• EFTR-2
• hRTEF-1B
• related transcription enhancer factor 1B
• RTEF1RTEF-1
• TCF13L1MGC9014
• TEA domain family member 4TEF3
• TEAD-4
• TEF-3
• TEFR-1
• Transcription factor 13-like 1
• Transcription factor RTEF-1
• transcriptional enhancer factor 1-related
• transcriptional enhancer factor 3
• transcriptional enhancer factor TEF-3

Background

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD4
• Uniprot:
  • Q15561(Human)