Home » TDRD9 » TDRD9 Antibodies » TDRD9 Antibody

TDRD9 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TDRD9 Antibody [NBP2-84297] - Host: Rabbit. Target Name: TDRD9. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: TDRD9 Antibody [NBP2-84297] - Host: Rabbit. Target Name: TDRD9. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TDRD9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9. Peptide sequence: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (93%), Canine (93%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDRD9 Antibody

  • C14orf75
  • chromosome 14 open reading frame 75
  • DKFZp434N0820
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ36164
  • HIG-1
  • hypoxia-inducible HIG-1
  • MGC135025
  • NET54
  • putative ATP-dependent RNA helicase TDRD9
  • tudor domain containing 9
  • Tudor domain-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PIWIL4 Antibody
(10G9B11)
NBP2-37398
Western Blot: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Western blot analysis using PIWIL4 mouse mAb against PC-3 (1) and PANC-1 (2) cell lysate.
Immunohistochemistry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using PIWIL4 mouse mAb with DAB staining.
Flow Cytometry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Flow cytometric analysis of HeLa cells using PIWIL4 mouse mAb (green) and negative control (purple).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
PIWIL2 Antibody
NBP2-24590
Western Blot: PIWIL2 Antibody [NBP2-24590] - Analysis of Mili in mouse embryo testis lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: PIWIL2 Antibody [NBP2-24590] - Immunohistochemical analysis of PIWIL2 in formalin-fixed, paraffin-embedded mouse testis tissue using an isotype control (top left) and NBP2-24590 (bottom left, right) at 5 ug/ml.
Species: Mu
Applications: WB, IHC, IHC-P
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
TDRD7 Antibody
NBP1-98585
Western Blot: TDRD7 Antibody [NBP1-98585] - Rat Small Intestine Lysate 1.0ug/ml
Species: Rt
Applications: WB
DDX6 Antibody
NB200-191
Immunocytochemistry/Immunofluorescence: DDX6 Antibody [NB200-191] - In normal condition, cells were fixed and stained for DDX6, that usually punctuate in process bodies (PBs). Primary Antibody rabbit-anti-DDX6 diluted 1:1000. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: DDX6 Antibody [NB200-191] - Section of human colon carcinoma (left) and mouse renal cell carcinoma(right). Antibody: Affinity purified rabbit anti-DDX6 used at a dilution of 1:200 (1ug/ml). Detection: DAB.
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
(1 Review)
(35 Publications)
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
RPLP1 Antibody
NBP1-81293
Western Blot: RPLP1 Antibody [NBP1-81293] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: RPLP1 Antibody [NBP1-81293] - Staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
VASA Antibody
[Unconjugated]
AF2030
VASA Antibody [Unconjugated]
(2 Reviews)
(22 Publications)
Species: Hu
Applications: WB, IHC
Perforin Antibody
(CB5.4)
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
B3GALNT1 Antibody
NBP2-92677
Western Blot: B3GALNT1 Antibody [NBP2-92677] - Analysis of extracts of various cell lines, using B3GALNT1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Immunocytochemistry/Immunofluorescence: B3GALNT1 Antibody [NBP2-92677] - Analysis of U2OS cells using B3GALNT1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
TDRD1 Antibody
AF7320
TDRD1 Antibody
Species: Mu
Applications: WB
MAEL Antibody
NBP1-77139
Western Blot: MAEL Antibody [NBP1-77139] - HeLa cell lysate with MAEL antibody at 1 ug/mL.
Immunocytochemistry/Immunofluorescence: MAEL Antibody [NBP1-77139] - Immunofluorescence of Maelstrom in HeLa cells with Maelstrom antibody at 20 ug/mL.
Immunocytochemistry/Immunofluorescence: MAEL Antibody [NBP1-77139] - HeLa cells with MAEL antibody at 5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
CD77 Synthase
Antibody
NBP1-62583
Western Blot: CD77 Synthase Antibody [NBP1-62583] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NUCKS1 Antibody
NB100-74635
Western Blot: NUCKS1 Antibody [NB100-74635] - Detection of Human NUCKS by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-NUCKS antibody NB100-74635 used for IP at 3 mcg/mg lysate. NUCKS was also immunoprecipitated by rabbit anti-NUCKS antibody NB100-74634, which recognizes an upstream epitope. Detection: Chemiluminescence with an exposure time of 30 seconds
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Detection of human NUCKS by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS (NB100-74635). Detection: DAB
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Exosome component
7 Antibody (OTI1G8)
NBP2-01732
Western Blot: Exosome component 7 Antibody (1G8) [NBP2-01732] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Exosome component 7 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: Exosome component 7 Antibody (1G8) [NBP2-01732] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Exosome component 7.
Immunohistochemistry-Paraffin: Exosome component 7 Antibody (1G8) [NBP2-01732] - Staining of paraffin-embedded Human tonsil using anti-Exosome component 7 mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - WB analysis of CANX in cell lysates as noted.
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Cite Ab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - Calnexin immunostaining in the anterior (AI) and mid (MI) intestine of ctrl (control zebrafish), D.I.O. (diet-induced obesity zebrafish), D.I.O. flw 3,5-T2 (D.I.O. zebrafish followed by 3,5-T2), D.I.O. with 3,5-T2 (D.I.O. zebrafish treated with 3,5-T2). (A) AI of ctrl zebrafish (B) AI of D.I.O. (C) AI of D.I.O. flw 3,5-T2. (D) AI of D.I.O. with 3,5-T2. The arrows indicate calnexin immunoexpression in the enteroendocrine and goblet cells. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2076-2615/10/7/1131/htm#) licensed under a CC-BY licence.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Splicing factor,
arginine/serine-rich ...
NBP1-87381
Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Analysis in control (vector only transfected HEK293T lysate) and SRSF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-87381] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RNPC3 Antibody
NBP1-57138
Western Blot: RNPC3 Antibody [NBP1-57138] - Human Spleen lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
Perilipin Antibody
NB110-40760
Western Blot: Perilipin Antibody [NB110-40760] - Total protein from Human breast (lane 1), Human adipose membrane fraction (lane 2) and Human adipose tissue (lane 3) were separated on a 12% gel by SDS-PAGE. Protein was transferred to PVDF membrane, probed with 2 ug/mL anti-perilipin antibody followed by anti-rabbit HRP conjugated secondary antibody and detected with chemiluminescence.
Immunohistochemistry-Paraffin: Perilipin Antibody [NB110-40760] - IHC analysis of formalin fixed paraffin embedded section of liver tissue from mouse with Perilipin antibody at 1:200 dilution. The hepatocytes developed specific staining in the cytoplasm and around the nuclei of some cells, the immunostaining reflected a punctate appearance which is potentially the ER of the cells.
Flow Cytometry: Perilipin Antibody [NB110-40760] - An intracellular stain was performed on U2OS cells with Perilipin Antibody NB110-40760AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Po, Fi
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IMC
GW182 Antibody
NBP1-28751
Western Blot: GW182 Antibody [NBP1-28751] - Detection of Human GW182 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells. Antibodies: Affinity purified rabbit anti-GW182 antibody NBP1-28751 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
GW182 Antibody [NBP1-28751] - Detection of human GW182 by western blot of immunoprecipitates. Samples: Whole cell lysate (50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-GW182 antibodyNBP1-28751 (lot NBP1-28751-2) used for IP at 6 ug/mg lysate. GW182 was also immunoprecipitated by a previous lot (lot NBP1-28751-1) of this antibody. For blotting immunoprecipitated GW182, NBP1-28751 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Knockdown Validated: GW182 Antibody [NBP1-28751] - Downregulation of eIF4E2 increases the protein levels of endogenous IMP1. HeLa cells were transfected with siRNAs indicated. At 48 h posttransfection, cells were lysed. A fraction of the lysate was subjected to SDS-PAGE followed by Western blotting. Image collected and cropped by CiteAb from the following publication (link.springer.com/10.1007/s13238-017-0444-0), licensed under a CC-BY licence.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: WB, IB, IP, KD

Publications for TDRD9 Antibody (NBP2-84297) (0)

There are no publications for TDRD9 Antibody (NBP2-84297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD9 Antibody (NBP2-84297) (0)

There are no reviews for TDRD9 Antibody (NBP2-84297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDRD9 Antibody (NBP2-84297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TDRD9 Products

Array NBP2-84297

Bioinformatics Tool for TDRD9 Antibody (NBP2-84297)

Discover related pathways, diseases and genes to TDRD9 Antibody (NBP2-84297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD9 Antibody (NBP2-84297)

Discover more about diseases related to TDRD9 Antibody (NBP2-84297).
 

Pathways for TDRD9 Antibody (NBP2-84297)

View related products by pathway.

PTMs for TDRD9 Antibody (NBP2-84297)

Learn more about PTMs related to TDRD9 Antibody (NBP2-84297).

Blogs on TDRD9

There are no specific blogs for TDRD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TDRD9