TDRD9 Antibody

Images

 
Western Blot: TDRD9 Antibody [NBP2-84297] - Host: Rabbit. Target Name: TDRD9. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9. Peptide sequence: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (93%), Canine (93%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDRD9 Antibody

  • C14orf75
  • chromosome 14 open reading frame 75
  • DKFZp434N0820
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ36164
  • HIG-1
  • hypoxia-inducible HIG-1
  • MGC135025
  • NET54
  • putative ATP-dependent RNA helicase TDRD9
  • tudor domain containing 9
  • Tudor domain-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-24590
Species: Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-98585
Species: Rt
Applications: WB
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2030
Species: Hu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF7320
Species: Mu
Applications: WB
NBP1-77139
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-62583
Species: Hu
Applications: WB
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01732
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57138
Species: Hu
Applications: WB
NB110-40760
Species: Hu, Mu, Rt, Po, Fi
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IMC
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP, KD

Publications for TDRD9 Antibody (NBP2-84297) (0)

There are no publications for TDRD9 Antibody (NBP2-84297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD9 Antibody (NBP2-84297) (0)

There are no reviews for TDRD9 Antibody (NBP2-84297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDRD9 Antibody (NBP2-84297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TDRD9 Products

Array NBP2-84297

Bioinformatics Tool for TDRD9 Antibody (NBP2-84297)

Discover related pathways, diseases and genes to TDRD9 Antibody (NBP2-84297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD9 Antibody (NBP2-84297)

Discover more about diseases related to TDRD9 Antibody (NBP2-84297).
 

Pathways for TDRD9 Antibody (NBP2-84297)

View related products by pathway.

PTMs for TDRD9 Antibody (NBP2-84297)

Learn more about PTMs related to TDRD9 Antibody (NBP2-84297).

Blogs on TDRD9

There are no specific blogs for TDRD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD9