TCP11 Antibody - BSA Free

Western Blot: TCP11 Antibody [NBP1-57698] - Human Small Intestine, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TCP11 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TCP11 (t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCP11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Knockout Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Knockout data (PMID: 31837139). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31837139).
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31837139).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TCP11 Antibody - BSA Free

• D6S230E
• KIAA0229
• MGC111103
• t-complex 11 (a murine tcp homolog)
• t-complex 11 homolog (mouse)
• T-complex protein 11 homolog

Background

TCP11 may play an important role in sperm function and fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TCP11 Antibody (NBP1-57698)(2)

Publications using NBP1-57698

• Castaneda JM, Miyata H, Archambeault DR Mouse T-complex protein 11 is important for progressive motility in sperm Biol. Reprod. 2019-12-14 [PMID: 31837139] (KO, WB, ICC/IF, Mouse)
• Stanger SJ, Law EA, Jamsai D et al. A novel germ cell protein, SPIF (sperm PKA interacting factor), is essential for the formation of a PKA/TCP11 complex that undergoes conformational and phosphorylation changes upon capacitation. FASEB J 2016-08-01 [PMID: 27105888]

Bioinformatics

• Gene Symbol: TCP11
• Entrez:
  • 6954(Human)
  • 21463(Mouse)
• Uniprot:
  • Q8WWU5(Human)