TCL1A Antibody (2F1)


Immunocytochemistry/ Immunofluorescence: TCL1A Antibody (2F1) [H00008115-M03] - Analysis of monoclonal antibody to TCL1A on HeLa cell. Antibody concentration 10 ug/ml
ELISA: TCL1A Antibody (2F1) [H00008115-M03] - Detection limit for recombinant GST tagged TCL1A is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF

Order Details

TCL1A Antibody (2F1) Summary

TCL1A (NP_068801.1 61 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
TCL1A (2F1)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCL1A Antibody (2F1)

  • Oncogene TCL1
  • Oncogene TCL-1
  • Protein p14 TCL1
  • T-cell leukemia/lymphoma 1A
  • T-cell lymphoma-1
  • T-cell lymphoma-1A
  • TCL1A
  • TCL1-PEN
  • TCL1T-cell leukemia/lymphoma protein 1A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: ELISA, ICC/IF

Publications for TCL1A Antibody (H00008115-M03) (0)

There are no publications for TCL1A Antibody (H00008115-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCL1A Antibody (H00008115-M03) (0)

There are no reviews for TCL1A Antibody (H00008115-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCL1A Antibody (H00008115-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TCL1A Products

Bioinformatics Tool for TCL1A Antibody (H00008115-M03)

Discover related pathways, diseases and genes to TCL1A Antibody (H00008115-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCL1A Antibody (H00008115-M03)

Discover more about diseases related to TCL1A Antibody (H00008115-M03).

Pathways for TCL1A Antibody (H00008115-M03)

View related products by pathway.

PTMs for TCL1A Antibody (H00008115-M03)

Learn more about PTMs related to TCL1A Antibody (H00008115-M03).

Blogs on TCL1A

There are no specific blogs for TCL1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TCL1A Antibody (2F1) and receive a gift card or discount.


Gene Symbol TCL1A