TCL1A Antibody (1E8) - Azide and BSA Free

Sandwich ELISA: TCL1A Antibody (1E8) [H00008115-M01] - Detection limit for recombinant GST tagged TCL1A is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TCL1A Antibody (1E8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
• Specificity: TCL1A (1E8)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TCL1A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCL1A Antibody (1E8) - Azide and BSA Free

• Oncogene TCL1
• Oncogene TCL-1
• Protein p14 TCL1
• T-cell leukemia/lymphoma 1A
• T-cell lymphoma-1
• T-cell lymphoma-1A
• TCL1A
• TCL1-PEN
• TCL1T-cell leukemia/lymphoma protein 1A

Background

Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCL1A
• Entrez:
  • 8115(Human)
• OMIM:
  • 186960(Human)
• Uniprot:
  • NP_068801(Human)