TCF19 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TCF19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TCF19 Antibody - BSA Free
Background
The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF
Publications for TCF19 Antibody (NBP3-17794) (0)
There are no publications for TCF19 Antibody (NBP3-17794).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TCF19 Antibody (NBP3-17794) (0)
There are no reviews for TCF19 Antibody (NBP3-17794).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCF19 Antibody (NBP3-17794) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCF19 Products
Research Areas for TCF19 Antibody (NBP3-17794)
Find related products by research area.
|
Blogs on TCF19