TCF19 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TCF19 Antibody [NBP3-17794] - Staining of human cell line BJ shows localization to nucleoplasm & intermediate filaments.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCF19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TCF19 Antibody - BSA Free (NBP3-17794) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TCF19 Antibody - BSA Free

• SC1(TCF19)-6
• SC1-1
• SC1SC1(TCF19)-7
• SCI(TCF19)-4
• TCF-19
• transcription factor 19
• Transcription factor SC1

Background

The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCF19