We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human TCF-2/HNF-1 beta GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TCF-2/HNF-1 beta Protein [H00006928-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related TCF-2/HNF-1 beta Peptides and Proteins

Order Details


    • Catalog Number
      H00006928-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TCF-2/HNF-1 beta GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_000449.1) for Human TCF-2/HNF-1 beta

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HNF1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TCF-2/HNF-1 beta GST (N-Term) Protein

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Background

TCF2 encodes transcription factor 2, a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The TCF2 protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1; depending on the TCF2 isoform, the result may be to activate or inhibit transcription of target genes. Mutation of TCF2 that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). A third human transcript variant is believed to exist based on such a variant in the rat: however, to date such an mRNA species has not been isolated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
NBP1-89679
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
AF6277
Species: Hu
Applications: ICC, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF5175
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB8224
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
H00006928-Q02
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02) (0)

There are no publications for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02) (0)

There are no reviews for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCF-2/HNF-1 beta Products

Research Areas for TCF-2/HNF-1 beta Recombinant Protein (H00006928-Q02)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TCF-2/HNF-1 beta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF1B