| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3E11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP |
| Specificity | TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (3E11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HNF1B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00006928-M02 | Applications | Species |
|---|---|---|
| Debiais-Delpech C, Godet J, Pedretti N et al. Expression patterns of candidate susceptibility genes HNF1? and CtBP2 in prostate cancer: Association with tumor progression. Urol Oncol 2013-12-11 [PMID: 24332637] |
Secondary Antibodies |
Isotype Controls |
Research Areas for TCF-2/HNF-1 beta Antibody (H00006928-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.