Recombinant Human TBX6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBX6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 191-299 of Human TBX6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBX6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBX6 Protein

  • DFNB67
  • T-box 6
  • T-box protein 6
  • T-box transcription factor TBX6
  • TBX6

Background

TBX6 - T-box 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
AF2085
Species: Hu, Mu
Applications: WB, IHC, ChIP, ICC
NBP2-37424
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBX6 Partial Recombinant Protein (H00006911-Q01) (0)

There are no publications for TBX6 Partial Recombinant Protein (H00006911-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX6 Partial Recombinant Protein (H00006911-Q01) (0)

There are no reviews for TBX6 Partial Recombinant Protein (H00006911-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBX6 Partial Recombinant Protein (H00006911-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBX6 Products

Bioinformatics Tool for TBX6 Partial Recombinant Protein (H00006911-Q01)

Discover related pathways, diseases and genes to TBX6 Partial Recombinant Protein (H00006911-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX6 Partial Recombinant Protein (H00006911-Q01)

Discover more about diseases related to TBX6 Partial Recombinant Protein (H00006911-Q01).
 

Pathways for TBX6 Partial Recombinant Protein (H00006911-Q01)

View related products by pathway.

PTMs for TBX6 Partial Recombinant Protein (H00006911-Q01)

Learn more about PTMs related to TBX6 Partial Recombinant Protein (H00006911-Q01).

Blogs on TBX6

There are no specific blogs for TBX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBX6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX6
Entrez