Home » TBL2 » TBL2 Proteins » Recombinant Human TBL2 GST (N-Term) Protein

Recombinant Human TBL2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human TBL2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 91-190 of Human TBL2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKREDGGYTFTATPEDFPKKHKAP
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBL2 GST (N-Term) Protein

  • DKFZp434N024
  • DKFZP43N024
  • MGC134739
  • transducin (beta)-like 2
  • transducin beta-like protein 2
  • WBSCR13WS-betaTRPWS beta-transducin repeats protein
  • Williams-Beuren syndrome chromosomal region 13 protein
  • Williams-Beuren syndrome chromosome region 13

Background

TBL2 - transducin (beta)-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human kidney stained with Elastin antibody.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Presence of ECM proteins collagen, elastin, fibronectin, vitronectin and GAGs following decellularization. Porcine vena cavas were decellularized and analyzed for ECM proteins. Cross-section of paraffin embedded samples were immunostained for collagen type I/III, elastin, fibronectin and vitronectin. Images were taken at identical microscopy settings. Scale bar is 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0220743), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human renal cell carcinoma stained with Elastin antibody (NB100-2076)
(2 Reviews)
(5 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
CHREBP Antibody -
BSA Free
NB400-135
Immunohistochemistry-Paraffin: CHREBP Antibody [NB400-135] - Staining of human colon, epithelium at a 40X magnification.
Chromatin Immunoprecipitation: CHREBP Antibody [NB400-135] - Effects of glucose on ChREBP binding.HepG2 cells were treated with low (2.7 mM) and high (25 mM) glucose for 8 h. Chromatin was isolated and fragmented, and ChIP was performed with control IgG or anti-ChREBP antibody. Validated primers for each gene were used for quantitative real-time PCR. The data presented as fold increase for the signal from anti-ChREBP relative to control IgG. The negative control, Cyclo, showed no enrichment (data not shown). Values represent the mean +/- S.D. of three independent samples. *p<0.005 vs. IgG, #p<0.0001 vs. 2.7 mM glucose with anti-ChREBP. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0022544), licensed under a CC-BY licence.
Western Blot: CHREBP Antibody [NB400-135] - RetSat depletion in mouse liver reduces protein levels and target gene expression of ChREBP. RetSat and ChREBP protein expression by immunoblotting. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-017-00430-w), licensed under a CC-BY licence.
(7 Reviews)
(125 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO, PAGE, WB
TRIB1 Antibody
NBP1-55386
Western Blot: TRIB1 Antibody [NBP1-55386] - COLO205, Antibody Dilution: 1.0 ug/ml TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.
Western Blot: TRIB1 Antibody [NBP1-55386] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: TRIB1 Antibody [NBP1-55386] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Intestine
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GALNT2 Antibody
AF7507
Western blot shows lysates of MOLT‑4 human acute lymphoblastic leukemia cell line, HeLa human cervical epithelial carcinoma cell line, and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Polypeptide GalNac Transferase 2/GALNT2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7507) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Polypeptide GalNac Transferase 2/GALNT2 at approximately 65-70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Polypeptide GalNac Transferase 2/GALNT2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Sheep Anti-Human Polypeptide GalNac Transferase 2/GALNT2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7507) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to the trans-Golgi secretory reticulum. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
Species: Hu
Applications: ICC, WB
Angiopoietin-like
Protein 3/ANGPTL3 Ant ...
AF136
Western blot shows lysates of mouse liver tissue and Hepa 1‑6 mouse hepatoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse Angiopoietin‑like Protein 3/ANGPTL3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF136) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Angiopoietin‑like Protein 3/ANGPTL3 at approximately 35 kDa (major band) and 52 & 63 kDa (minor bands, as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Angiopoietin-like 3 was detected in perfusion fixed frozen sections of mouse liver using Goat Anti-Mouse Angiopoietin-like 3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF136) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of hepatocytes. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Publications)
Species: Mu
Applications: IHC, WB
MAP4K5 Antibody
NBP1-31234
Immunoprecipitation: MAP4K5 Antibody [NBP1-31234] - Immunoprecipitation of KHS protein from 293T whole cell extracts using 5 ug of KHS antibody. Western blot analysis was performed using KHS antibody.EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunocytochemistry/Immunofluorescence: MAP4K5 Antibody [NBP1-31234] - Analysis of A431, using MAP4K5 antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: MAP4K5 Antibody [NBP1-31234] - SAS xenograft, using KHS antibody at 1:100 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Apolipoprotein A5
Antibody (1G5G9)
NB400-139
Western Blot: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Analysis using anti- human APOA5 monoclonal antibody against human serum total protein (lane 2). Lane 1 is a MW standard.
Western Blot: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Detection of Apo A5 in HepG2 cell lysate with NB400-139.
Flow Cytometry: Apolipoprotein A5 Antibody (1G5G9) [NB400-139] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using Apolipoprotein A5 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Publications)
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(28 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
GCKR Antibody
(OTI1E7)
NBP2-03396
Western Blot: GCKR Antibody (1E7) [NBP2-03396] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GCKR (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-GCKR.
Immunohistochemistry-Paraffin: GCKR Antibody (1E7) [NBP2-03396] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-GCKR mouse monoclonal antibody.
Immunohistochemistry-Paraffin: GCKR Antibody (1E7) [NBP2-03396] - Staining of paraffin-embedded Human Kidney tissue using anti-GCKR mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BCL7B Antibody
(6D2)
H00009275-M01
Immunocytochemistry/Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of monoclonal antibody to BCL7B on HeLa cell . Antibody concentration 10 ug/ml.
Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.Lane 1: BCL7B transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - BCL7B monoclonal antibody (M01), clone 6D2. Analysis of BCL7B expression in MCF-7.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
UBIAD1 Antibody
NBP2-93402
Immunocytochemistry/Immunofluorescence: UBIAD1 Antibody [NBP2-93402] - Analysis of U2OS cells using UBIAD1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: UBIAD1 Antibody [NBP2-93402] - Paraffin-embedded human colon carcinoma using UBIAD1 .
Immunohistochemistry-Paraffin: UBIAD1 Antibody [NBP2-93402] - Paraffin-embedded human prostate using UBIAD1 .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
RFC2 Antibody
(OTI2B2) - Azide and ...
NBP2-73857
Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.
Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Adenocarcinoma of Human endometrium tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
FKBP6 Antibody
NBP3-04676
Immunocytochemistry/Immunofluorescence: FKBP6 Antibody [NBP3-04676] - Analysis of A-549 cells using FKBP6 antibody . Blue: DAPI for nuclear staining.
Western Blot: FKBP6 Antibody [NBP3-04676] - Analysis of extracts of various cell lines, using FKBP6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunohistochemistry-Paraffin: FKBP6 Antibody [NBP3-04676] - Paraffin-embedded mouse kidney using FKBP6 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SKIV2L Antibody
NBP2-47274
Western Blot: SKIV2L Antibody [NBP2-47274] - Analysis in control (vector only transfected HEK293T lysate) and SKIV2L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: SKIV2L Antibody [NBP2-47274] - Staining of human cell line HeLa shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKIV2L Antibody [NBP2-47274] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cytochrome P450
3A4 Antibody (3H8) - ...
NBP2-37502
ELISA: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against human CYP3A4 (AA: 243-430) recombinant protein. (Expected MW is 47.5 kDa)
Western Blot: Cytochrome P450 3A4 Antibody (3H8) [NBP2-37502] - Analysis using CYP3A4 mAb against HEK293 (1) and CYP3A4 (AA: 243-430)-hIgGFc transfected HEK293 (2) cell lysate.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Plastin L Antibody
NBP2-19860
Western Blot: Plastin L Antibody [NBP2-19860] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with L-Plastin antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Plastin L Antibody [NBP2-19860] - arious whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with L-Plastin antibody diluted at 1:10000.
Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP2-19860] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: L-Plastin protein stained by L-Plastin antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Syntaxin 1A
Antibody (2B2F10)
NBP3-15706
Immunohistochemistry-Paraffin: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Immunohistochemistry of paraffin-embedded mouse brain using Syntaxin 1A Rabbit mAb (NBP3-15706) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Immunofluorescence analysis of rat brain using Syntaxin 1A Rabbit mAb (NBP3-15706) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Immunofluorescence analysis of mouse brain using Syntaxin 1A Rabbit mAb (NBP3-15706) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CYLN2 Antibody
NBP1-85569
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CYLN2 Antibody [NBP1-85569] - Staining of human kidney shows low expression as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
TBL2 GST (N-Term) Pro ...
H00026608-Q01
Recombinant Human TBL2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no publications for TBL2 Partial Recombinant Protein (H00026608-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no reviews for TBL2 Partial Recombinant Protein (H00026608-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBL2 Products

Bioinformatics Tool for TBL2 Partial Recombinant Protein (H00026608-Q01)

Discover related pathways, diseases and genes to TBL2 Partial Recombinant Protein (H00026608-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBL2 Partial Recombinant Protein (H00026608-Q01)

Discover more about diseases related to TBL2 Partial Recombinant Protein (H00026608-Q01).
 

Pathways for TBL2 Partial Recombinant Protein (H00026608-Q01)

View related products by pathway.

Blogs on TBL2

There are no specific blogs for TBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: CHREBP Antibody [NB400-135] - Staining of human colon, epithelium at a 40X magnification.
CHREBP Antibody - BSA Free
NB400-135
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
NB110-60531

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBL2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TBL2