Recombinant Human TBL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 91-190 of Human TBL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKREDGGYTFTATPEDFPKKHKAP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBL2 Protein

  • DKFZp434N024
  • DKFZP43N024
  • MGC134739
  • transducin (beta)-like 2
  • transducin beta-like protein 2
  • WBSCR13WS-betaTRPWS beta-transducin repeats protein
  • Williams-Beuren syndrome chromosomal region 13 protein
  • Williams-Beuren syndrome chromosome region 13

Background

TBL2 - transducin (beta)-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-46205
Species: Hu
Applications: WB, IHC
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009275-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-468
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
H00026608-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no publications for TBL2 Partial Recombinant Protein (H00026608-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no reviews for TBL2 Partial Recombinant Protein (H00026608-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBL2 Partial Recombinant Protein (H00026608-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBL2 Products

Bioinformatics Tool for TBL2 Partial Recombinant Protein (H00026608-Q01)

Discover related pathways, diseases and genes to TBL2 Partial Recombinant Protein (H00026608-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBL2 Partial Recombinant Protein (H00026608-Q01)

Discover more about diseases related to TBL2 Partial Recombinant Protein (H00026608-Q01).
 

Pathways for TBL2 Partial Recombinant Protein (H00026608-Q01)

View related products by pathway.

Blogs on TBL2

There are no specific blogs for TBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHREBP Antibody
NB400-135
TBL2 Antibody
NBP2-20579

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBL2