Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC |
Clone | 6D2 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
Specificity | BCL7B - B-cell CLL/lymphoma 7B |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | BCL7B |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00009275-M01 | Applications | Species |
---|---|---|
Taniuchi K, Furihata M, Naganuma S et al. BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling. Am J Cancer Res 2018-03-01 [PMID: 29636996] |
Secondary Antibodies |
Isotype Controls |
Diseases for BCL7B Antibody (H00009275-M01)Discover more about diseases related to BCL7B Antibody (H00009275-M01).
| Pathways for BCL7B Antibody (H00009275-M01)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.