TBCD Antibody

Images

 
Western Blot: TBCD Antibody [NBP1-79913] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBCD Antibody Summary

Immunogen
The immunogen for this antibody is TBCD. Peptide sequence KLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBCD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against TBCD and was validated on Western blot.
Theoretical MW
131 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TBCD Antibody

  • Beta-tubulin cofactor D
  • KIAA0988
  • SSD1
  • SSD-1
  • tfcD
  • tubulin folding cofactor D
  • Tubulin-folding cofactor D
  • tubulin-specific chaperone d

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89130
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NBP2-02037
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79913
Species: Hu
Applications: WB

Publications for TBCD Antibody (NBP1-79913) (0)

There are no publications for TBCD Antibody (NBP1-79913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBCD Antibody (NBP1-79913) (0)

There are no reviews for TBCD Antibody (NBP1-79913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBCD Antibody (NBP1-79913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBCD Products

Bioinformatics Tool for TBCD Antibody (NBP1-79913)

Discover related pathways, diseases and genes to TBCD Antibody (NBP1-79913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBCD Antibody (NBP1-79913)

Discover more about diseases related to TBCD Antibody (NBP1-79913).
 

Pathways for TBCD Antibody (NBP1-79913)

View related products by pathway.

PTMs for TBCD Antibody (NBP1-79913)

Learn more about PTMs related to TBCD Antibody (NBP1-79913).

Blogs on TBCD

There are no specific blogs for TBCD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBCD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBCD
Uniprot