TBC1D23 Antibody

Images

 
Western Blot: TBC1D23 Antibody [NBP1-90421] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: TBC1D23 Antibody [NBP1-90421] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: TBC1D23 Antibody [NBP1-90421] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDRVGKPYRGVKPVFSIGDEEEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBC1D23 Protein (NBP1-90421PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D23 Antibody

  • DKFZp667G062
  • HCV non-structural protein 4A-transactivated protein 1
  • HCV nonstructural protein 4A-transactivated protein 1
  • TBC1 domain family member 23
  • TBC1 domain family, member 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
H00058508-R04
Species: Hu
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56630
Species: Hu
Applications: WB
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009124-D01P
Species: Hu
Applications: WB, ELISA
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBC1D23 Antibody (NBP1-90421) (0)

There are no publications for TBC1D23 Antibody (NBP1-90421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D23 Antibody (NBP1-90421) (0)

There are no reviews for TBC1D23 Antibody (NBP1-90421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBC1D23 Antibody (NBP1-90421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBC1D23 Products

Bioinformatics Tool for TBC1D23 Antibody (NBP1-90421)

Discover related pathways, diseases and genes to TBC1D23 Antibody (NBP1-90421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D23 Antibody (NBP1-90421)

Discover more about diseases related to TBC1D23 Antibody (NBP1-90421).
 

Pathways for TBC1D23 Antibody (NBP1-90421)

View related products by pathway.

Blogs on TBC1D23

There are no specific blogs for TBC1D23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D23