TASK-5/KCNK15 Antibody - BSA Free

Western Blot: TASK-5/KCNK15 Antibody [NBP2-83617] - WB Suggested Anti-KCNK15 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TASK-5/KCNK15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TASK-5/KCNK15 Antibody - BSA Free (NBP2-83617) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TASK-5/KCNK15. Peptide sequence: ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TASK-5/KCNK15 Antibody - BSA Free

• Acid-sensitive potassium channel protein TASK-5
• dJ781B1.1
• K2p15.1
• KCNK11
• KCNK14
• KCNK15
• KIAA0237
• KT3.3
• potassium channel subfamily K member 15
• potassium channel, subfamily K, member 14
• potassium channel, subfamily K, member 15
• TASK5
• TASK-5
• TASK5Two pore potassium channel KT3.3
• TWIK-related acid-sensitive K(+) channel 5
• Two pore K(+) channel KT3.3

Background

The KCNK15 gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming Pdomains. The product of this gene has not been shown to be a functional channel, however, it may require othernon-pore-forming proteins for

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNK15