TAS2R38 Antibody

Images

 
Immunohistochemistry: TAS2R38 Antibody [NBP2-33404] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAS2R38 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLGRHMRTMKVYTRNSRDPSLEAHIKALKS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAS2R38
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAS2R38 Protein (NBP2-33404PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAS2R38 Antibody

  • PTCphenylthiocarbamide tasting
  • T2R38
  • T2R61PTC bitter taste receptor
  • taste receptor type 2 member 38
  • Taste receptor type 2 member 61
  • taste receptor, type 2, member 38

Background

The STAS2R38 gene encodes a 333 amino acid long, 37 kDA taste receptor type 2 member 38 protein that obtains the ability to identify the perception of bitterness as it obtains the capabilities of tasting glucosinolates. Additionally, many believe that this receptor has the ability to stimulate alpha gustducin to regulate PLC-beta-2 activation. In doing so, it would lead to the gating of TRPM5. Therefore, the STAS2R38 gene is involved in taste transduction and bitter taste signaling. It has been researched regarding its role in thyroiditis, dental caries, nicotine dependence, motion sickness, phenylthiocarbamide tasting, coronary heart disease, alcoholism, and twining.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAS2R38 Antibody (NBP2-33404) (0)

There are no publications for TAS2R38 Antibody (NBP2-33404).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R38 Antibody (NBP2-33404) (0)

There are no reviews for TAS2R38 Antibody (NBP2-33404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAS2R38 Antibody (NBP2-33404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAS2R38 Products

Research Areas for TAS2R38 Antibody (NBP2-33404)

Find related products by research area.

Blogs on TAS2R38

There are no specific blogs for TAS2R38, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAS2R38 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAS2R38
Uniprot