TAS2R38 Antibody


Immunohistochemistry: TAS2R38 Antibody [NBP2-33404] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TAS2R38 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SLGRHMRTMKVYTRNSRDPSLEAHIKALKS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAS2R38 Protein (NBP2-33404PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TAS2R38 Antibody

  • PTCphenylthiocarbamide tasting
  • T2R38
  • T2R61PTC bitter taste receptor
  • taste receptor type 2 member 38
  • Taste receptor type 2 member 61
  • taste receptor, type 2, member 38


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu

Publications for TAS2R38 Antibody (NBP2-33404) (0)

There are no publications for TAS2R38 Antibody (NBP2-33404).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R38 Antibody (NBP2-33404) (0)

There are no reviews for TAS2R38 Antibody (NBP2-33404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAS2R38 Antibody (NBP2-33404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TAS2R38 Products

Bioinformatics Tool for TAS2R38 Antibody (NBP2-33404)

Discover related pathways, diseases and genes to TAS2R38 Antibody (NBP2-33404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAS2R38 Antibody (NBP2-33404)

Discover more about diseases related to TAS2R38 Antibody (NBP2-33404).

Pathways for TAS2R38 Antibody (NBP2-33404)

View related products by pathway.

Research Areas for TAS2R38 Antibody (NBP2-33404)

Find related products by research area.

Blogs on TAS2R38

There are no specific blogs for TAS2R38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TAS2R38 Antibody and receive a gift card or discount.


Gene Symbol TAS2R38