TAS2R38 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SLGRHMRTMKVYTRNSRDPSLEAHIKALKS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TAS2R38 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TAS2R38 Antibody - BSA Free
Background
The STAS2R38 gene encodes a 333 amino acid long, 37 kDA taste receptor type 2 member 38 protein that obtains the ability to identify the perception of bitterness as it obtains the capabilities of tasting glucosinolates. Additionally, many believe that this receptor has the ability to stimulate alpha gustducin to regulate PLC-beta-2 activation. In doing so, it would lead to the gating of TRPM5. Therefore, the STAS2R38 gene is involved in taste transduction and bitter taste signaling. It has been researched regarding its role in thyroiditis, dental caries, nicotine dependence, motion sickness, phenylthiocarbamide tasting, coronary heart disease, alcoholism, and twining.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Publications for TAS2R38 Antibody (NBP2-33404) (0)
There are no publications for TAS2R38 Antibody (NBP2-33404).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TAS2R38 Antibody (NBP2-33404) (0)
There are no reviews for TAS2R38 Antibody (NBP2-33404).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TAS2R38 Antibody (NBP2-33404) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TAS2R38 Products
Research Areas for TAS2R38 Antibody (NBP2-33404)
Find related products by research area.
|
Blogs on TAS2R38