TAS1R1 Antibody

Images

 
Immunohistochemistry-Paraffin: TAS1R1 Antibody [NBP1-83338] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAS1R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAS1R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAS1R1 Protein (NBP1-83338PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAS1R1 Antibody

  • GPR70
  • G-protein coupled receptor 70
  • seven transmembrane helix receptor
  • T1R1TR1G protein-coupled receptor 70
  • taste receptor type 1 member 1
  • taste receptor, type 1, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS2007
Species: Hu
Applications: IHC-P
NLS5060
Species: Hu
Applications: WB, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00091614-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-55133
Species: Hu
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready

Publications for TAS1R1 Antibody (NBP1-83338) (0)

There are no publications for TAS1R1 Antibody (NBP1-83338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS1R1 Antibody (NBP1-83338) (0)

There are no reviews for TAS1R1 Antibody (NBP1-83338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAS1R1 Antibody (NBP1-83338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAS1R1 Products

Bioinformatics Tool for TAS1R1 Antibody (NBP1-83338)

Discover related pathways, diseases and genes to TAS1R1 Antibody (NBP1-83338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAS1R1 Antibody (NBP1-83338)

Discover more about diseases related to TAS1R1 Antibody (NBP1-83338).
 

Pathways for TAS1R1 Antibody (NBP1-83338)

View related products by pathway.

Research Areas for TAS1R1 Antibody (NBP1-83338)

Find related products by research area.

Blogs on TAS1R1.

Taste Infographic: Explaining Taste from the Tongue to the Brain
The sense of taste involves the reaction of chemicals with nerve cells which send messages to the brain to create the perception of flavor. Learn more about taste and in the infographic below.Novus Biologicals offers research reagents mentioned in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAS1R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAS1R1